Clone BS16062 Report

Search the DGRC for BS16062

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:160
Well:62
Vector:pDNR-Dual
Associated Gene/TranscriptCG14812-RA
Protein status:BS16062.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS16062.3prime Sequence

333 bp (333 high quality bases) assembled on 2007-04-16

> BS16062.3prime
ATGGTCTAGAAAGCTTTTAGTTGCTGGGGGCGGTCGCCGATGTACCCGTC
GGCTGCTTGAAGATAACGCCTGTGATCTCGCCGTCCTTCTGGATGACACA
GCGTTTGTTTCCGCTGTAAAGGCAAATCGTTGCAGGAGCCGTGGCATTCA
GCTCCAGTTTGGCCACCTGCTCGGAAATGGCCATTCCGATGCCGGACACG
TTCGGATCAATGTCTCCTTTGGTGCCCAAACACAATCCCTGGCGATTGGC
CAGCAGAGCTCCCACTGTGTCCTGCCGTGCGGCGATTTCCGCTAGGACTT
TCTCCAGTTGCTGCTCCATGTCGACTGATAACT

BS16062.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:32:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG14812-PA 303 CG14812-RA 1..303 319..17 1515 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:10:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG14812-RB 802 CG14812-RB 69..372 320..17 1520 100 Minus
CG14812-RA 720 CG14812-RA 69..372 320..17 1520 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 16:10:21
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1858561..1858678 105..222 590 100 Plus
X 23542271 X 1858319..1858406 17..104 440 100 Plus
X 23542271 X 1858736..1858797 223..284 310 100 Plus
X 23542271 X 1858868..1858903 285..320 180 100 Plus
Blast to na_te.dros performed on 2015-02-13 16:10:22 has no hits.

BS16062.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:45 Download gff for BS16062.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14812-PA 1..303 17..319 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 12:57:35 Download gff for BS16062.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14812-RA 89..397 17..328 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 18:39:01 Download gff for BS16062.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14812-RA 64..372 17..328 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 18:39:01 Download gff for BS16062.3prime
Subject Subject Range Query Range Percent Splice Strand
X 1858319..1858406 17..104 100 <- Plus
X 1858561..1858678 105..222 100 <- Plus
X 1858736..1858797 223..284 100 <- Plus
X 1858868..1858908 285..328 93   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 12:57:35 Download gff for BS16062.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 1752352..1752439 17..104 100 <- Plus
arm_X 1752594..1752711 105..222 100 <- Plus
arm_X 1752769..1752830 223..284 100 <- Plus
arm_X 1752901..1752941 285..328 93   Plus

BS16062.5prime Sequence

333 bp (333 high quality bases) assembled on 2007-04-16

> BS16062.5prime
GAAGTTATCAGTCGACATGGAGCAGCAACTGGAGAAAGTCCTAGCGGAAA
TCGCCGCACGGCAGGACACAGTGGGAGCTCTGCTGGCCAATCGCCAGGGA
TTGTGTTTGGGCACCAAAGGAGACATTGATCCGAACGTGTCCGGCATCGG
AATGGCCATTTCCGAGCAGGTGGCCAAACTGGAGCTGAATGCCACGGCTC
CTGCAACGATTTGCCTTTACAGCGGAAACAAACGCTGTGTCATCCAGAAG
GACGGCGAGATCACAGGCGTTATCTTCAAGCAGCCGACGGGTACATCGGC
GACCGCCCCCAGCAACTAAAAGCTTTCTAGACC

BS16062.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:32:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG14812-PA 303 CG14812-RA 1..303 17..319 1515 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 23:08:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG14812-RB 802 CG14812-RB 69..372 16..319 1520 100 Plus
CG14812-RA 720 CG14812-RA 69..372 16..319 1520 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 23:08:31
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1858561..1858678 231..114 590 100 Minus
X 23542271 X 1858319..1858406 319..232 440 100 Minus
X 23542271 X 1858736..1858797 113..52 310 100 Minus
X 23542271 X 1858868..1858903 51..16 180 100 Minus
Blast to na_te.dros performed on 2015-02-11 23:08:35 has no hits.

BS16062.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:45 Download gff for BS16062.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14812-PA 1..303 17..319 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 04:44:27 Download gff for BS16062.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14812-RA 89..397 8..319 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:33:52 Download gff for BS16062.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14812-RA 64..372 8..319 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 01:33:52 Download gff for BS16062.5prime
Subject Subject Range Query Range Percent Splice Strand
X 1858319..1858406 232..319 100 <- Minus
X 1858561..1858678 114..231 100 <- Minus
X 1858736..1858797 52..113 100 <- Minus
X 1858868..1858908 8..51 93   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 04:44:27 Download gff for BS16062.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 1752352..1752439 232..319 100 <- Minus
arm_X 1752594..1752711 114..231 100 <- Minus
arm_X 1752769..1752830 52..113 100 <- Minus
arm_X 1752901..1752941 8..51 93   Minus

BS16062.complete Sequence

335 bp assembled on 2007-05-07

GenBank Submission: FJ638043

> BS16062.complete
GAAGTTATCAGTCGACATGGAGCAGCAACTGGAGAAAGTCCTAGCGGAAA
TCGCCGCACGGCAGGACACAGTGGGAGCTCTGCTGGCCAATCGCCAGGGA
TTGTGTTTGGGCACCAAAGGAGACATTGATCCGAACGTGTCCGGCATCGG
AATGGCCATTTCCGAGCAGGTGGCCAAACTGGAGCTGAATGCCACGGCTC
CTGCAACGATTTGCCTTTACAGCGGAAACAAACGCTGTGTCATCCAGAAG
GACGGCGAGATCACAGGCGTTATCTTCAAGCAGCCGACGGGTACATCGGC
GACCGCCCCCAGCAACTAAAAGCTTTCTAGACCAT

BS16062.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 01:18:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG14812-RB 303 CG14812-PB 1..303 17..319 1515 100 Plus
CG14812-RA 303 CG14812-PA 1..303 17..319 1515 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:18:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG14812-RB 802 CG14812-RB 69..372 16..319 1520 100 Plus
CG14812-RA 720 CG14812-RA 69..372 16..319 1520 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 01:18:12
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1858561..1858678 231..114 590 100 Minus
X 23542271 X 1858319..1858406 319..232 440 100 Minus
X 23542271 X 1858736..1858797 113..52 310 100 Minus
X 23542271 X 1858868..1858903 51..16 180 100 Minus
Blast to na_te.dros performed on 2014-11-28 01:18:13 has no hits.

BS16062.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:20:12 Download gff for BS16062.complete
Subject Subject Range Query Range Percent Splice Strand
CG14812-RA 1..303 17..319 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:01:20 Download gff for BS16062.complete
Subject Subject Range Query Range Percent Splice Strand
CG14812-RA 44..352 8..319 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:45:38 Download gff for BS16062.complete
Subject Subject Range Query Range Percent Splice Strand
CG14812-RA 95..395 17..317 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:20:12 Download gff for BS16062.complete
Subject Subject Range Query Range Percent Splice Strand
CG14812-RA 44..352 8..319 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:50:23 Download gff for BS16062.complete
Subject Subject Range Query Range Percent Splice Strand
CG14812-RA 70..370 17..317 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:50:23 Download gff for BS16062.complete
Subject Subject Range Query Range Percent Splice Strand
X 1858736..1858797 52..113 100 <- Minus
X 1858868..1858902 17..51 100   Minus
X 1858321..1858406 232..317 100 <- Minus
X 1858561..1858678 114..231 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:45:38 Download gff for BS16062.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1752354..1752439 232..317 100 <- Minus
arm_X 1752594..1752711 114..231 100 <- Minus
arm_X 1752769..1752830 52..113 100 <- Minus
arm_X 1752901..1752935 17..51 100   Minus

BS16062.pep Sequence

Translation from 16 to 318

> BS16062.pep
MEQQLEKVLAEIAARQDTVGALLANRQGLCLGTKGDIDPNVSGIGMAISE
QVAKLELNATAPATICLYSGNKRCVIQKDGEITGVIFKQPTGTSATAPSN
*

BS16062.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:51:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG14812-PB 100 CG14812-PB 1..100 1..100 502 100 Plus
CG14812-PA 100 CG14812-PA 1..100 1..100 502 100 Plus