Clone BS16063 Report

Search the DGRC for BS16063

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:160
Well:63
Vector:pDNR-Dual
Associated Gene/Transcriptmex1-RA
Protein status:BS16063.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS16063.3prime Sequence

282 bp (282 high quality bases) assembled on 2007-04-16

> BS16063.3prime
ATGGTCTAGAAAGCTTTCAGTACTCCTTGTTGAAGTAGTCGCGTATGCTG
CGCTTCACAATGGGCGTCAGTTGGGCGACCTGCTTCTGCACCTCATCCGT
GTTCTTATCCTTGTGATAGAAGACCGTGAAGTAGACAATCAAGCCGATCA
CCACGACCATCAGGAGCGCAGAAAACACGATGCTCAGGAGCATCTTGCAG
GCGCAGGAACAGCAGCAGCAAACCACTTTGCCGGGACATTTGAGGCATTC
ACAGAGAGCGTTGCACATGTCGACTGATAACT

BS16063.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:32:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG7936-PA 252 mex1-RA 1..252 268..17 1260 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 20:59:42
Subject Length Description Subject Range Query Range Score Percent Strand
mex1-RC 1034 CG7936-RC 425..677 269..17 1265 100 Minus
mex1-RA 710 CG7936-RA 101..353 269..17 1265 100 Minus
mex1-RB 741 CG7936-RB 83..335 269..17 1160 97.2 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 20:59:37
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15517830..15518034 17..221 1010 99.5 Plus
3L 28110227 3L 15518308..15518361 216..269 270 100 Plus
Blast to na_te.dros performed 2015-02-10 20:59:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6747..6820 147..221 111 62.7 Plus

BS16063.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:46 Download gff for BS16063.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7936-PA 1..252 17..268 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 13:59:08 Download gff for BS16063.3prime
Subject Subject Range Query Range Percent Splice Strand
mex1-RA 92..356 12..282 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:39:01 Download gff for BS16063.3prime
Subject Subject Range Query Range Percent Splice Strand
mex1-RA 92..356 12..282 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:39:01 Download gff for BS16063.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 15517827..15518028 12..215 98 <- Plus
3L 15518308..15518370 216..282 92   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 13:59:08 Download gff for BS16063.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15510927..15511128 12..215 98 <- Plus
arm_3L 15511408..15511470 216..282 92   Plus

BS16063.5prime Sequence

282 bp (282 high quality bases) assembled on 2007-04-16

> BS16063.5prime
GAAGTTATCAGTCGACATGTGCAACGCTCTCTGTGAATGCCTCAAATGTC
CCGGCAAAGTGGTTTGCTGCTGCTGTTCCTGCGCCTGCAAGATGCTCCTG
AGCATCGTGTTTTCTGCGCTCCTGATGGTCGTGGTGATCGGCTTGATTGT
CTACTTCACGGTCTTCTATCACAAGGATAAGAACACGGATGAGGTGCAGA
AGCAGGTCGCCCAACTGACGCCCATTGTGAAGCGCAGCATACGCGACTAC
TTCAACAAGGAGTACTGAAAGCTTTCTAGACC

BS16063.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:32:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG7936-PA 252 mex1-RA 1..252 17..268 1260 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 13:07:22
Subject Length Description Subject Range Query Range Score Percent Strand
mex1-RC 1034 CG7936-RC 425..677 16..268 1265 100 Plus
mex1-RA 710 CG7936-RA 101..353 16..268 1265 100 Plus
mex1-RB 741 CG7936-RB 83..335 16..268 1160 97.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 13:07:20
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15517830..15518034 268..64 1010 99.5 Minus
3L 28110227 3L 15518308..15518361 69..16 270 100 Minus
Blast to na_te.dros performed 2015-02-13 13:07:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6747..6820 138..64 111 62.7 Minus

BS16063.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:46 Download gff for BS16063.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7936-PA 1..252 17..268 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 18:53:28 Download gff for BS16063.5prime
Subject Subject Range Query Range Percent Splice Strand
mex1-RA 91..356 2..273 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 15:28:51 Download gff for BS16063.5prime
Subject Subject Range Query Range Percent Splice Strand
mex1-RA 91..356 2..273 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 15:28:51 Download gff for BS16063.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 15517827..15518028 70..273 98 <- Minus
3L 15518308..15518361 16..69 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 18:53:28 Download gff for BS16063.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15510927..15511128 70..273 98 <- Minus
arm_3L 15511408..15511461 16..69 100 -> Minus

BS16063.complete Sequence

284 bp assembled on 2007-05-07

GenBank Submission: FJ638044

> BS16063.complete
GAAGTTATCAGTCGACATGTGCAACGCTCTCTGTGAATGCCTCAAATGTC
CCGGCAAAGTGGTTTGCTGCTGCTGTTCCTGCGCCTGCAAGATGCTCCTG
AGCATCGTGTTTTCTGCGCTCCTGATGGTCGTGGTGATCGGCTTGATTGT
CTACTTCACGGTCTTCTATCACAAGGATAAGAACACGGATGAGGTGCAGA
AGCAGGTCGCCCAACTGACGCCCATTGTGAAGCGCAGCATACGCGACTAC
TTCAACAAGGAGTACTGAAAGCTTTCTAGACCAT

BS16063.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:18:30
Subject Length Description Subject Range Query Range Score Percent Strand
mex1-RC 252 CG7936-PC 1..252 17..268 1260 100 Plus
mex1-RA 252 CG7936-PA 1..252 17..268 1260 100 Plus
mex1-RB 252 CG7936-PB 1..252 17..268 1155 97.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:18:31
Subject Length Description Subject Range Query Range Score Percent Strand
mex1-RC 1034 CG7936-RC 425..677 16..268 1265 100 Plus
mex1-RA 710 CG7936-RA 101..353 16..268 1265 100 Plus
mex1-RB 741 CG7936-RB 83..335 16..268 1160 97.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:18:28
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15517830..15518034 268..64 1010 99.5 Minus
3L 28110227 3L 15518308..15518361 69..16 270 100 Minus
Blast to na_te.dros performed 2014-11-27 10:18:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6747..6820 138..64 111 62.7 Minus

BS16063.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:09:53 Download gff for BS16063.complete
Subject Subject Range Query Range Percent Splice Strand
mex1-RA 1..252 17..268 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:51:31 Download gff for BS16063.complete
Subject Subject Range Query Range Percent Splice Strand
mex1-RA 86..351 2..273 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:37:48 Download gff for BS16063.complete
Subject Subject Range Query Range Percent Splice Strand
mex1-RA 102..352 17..267 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:09:53 Download gff for BS16063.complete
Subject Subject Range Query Range Percent Splice Strand
mex1-RA 86..351 2..273 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:18:25 Download gff for BS16063.complete
Subject Subject Range Query Range Percent Splice Strand
mex1-RA 102..352 17..267 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:18:25 Download gff for BS16063.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15517831..15518028 70..267 100 <- Minus
3L 15518308..15518360 17..69 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:37:48 Download gff for BS16063.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15510931..15511128 70..267 100 <- Minus
arm_3L 15511408..15511460 17..69 100   Minus

BS16063.pep Sequence

Translation from 16 to 267

> BS16063.pep
MCNALCECLKCPGKVVCCCCSCACKMLLSIVFSALLMVVVIGLIVYFTVF
YHKDKNTDEVQKQVAQLTPIVKRSIRDYFNKEY*

BS16063.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:47:32
Subject Length Description Subject Range Query Range Score Percent Strand
mex1-PC 83 CG7936-PC 1..83 1..83 450 100 Plus
mex1-PA 83 CG7936-PA 1..83 1..83 450 100 Plus
mex1-PB 83 CG7936-PB 1..83 1..83 447 97.6 Plus
CG42394-PC 77 CG42394-PC 1..75 5..81 149 36.4 Plus
CG42394-PB 77 CG42394-PB 1..75 5..81 149 36.4 Plus