Clone BS16065 Report

Search the DGRC for BS16065

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:160
Well:65
Vector:pDNR-Dual
Associated Gene/TranscriptCG18081-RA
Protein status:BS16065.pep: full length peptide match
Sequenced Size:16

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15715-RA 2009-01-21 est gleaning

Clone Sequence Records

BS16065.5prime Sequence

264 bp (264 high quality bases) assembled on 2007-04-16

> BS16065.5prime
GAAGTTATCAGTCGACATGGCACGTGGACACCAGAAGATCCAGTCGCAGG
CGAAGGCCTCCGAGAAGCAGGCCAAACTAAAGAAGCAACAAGGACACAGT
GCCAACGACCAGAAGAAGGCGGCCCAGAAGGCACTTGTCTATGTGTGCGC
CGTTTGCAAGTCGCAAATGCCCGATCCGAAGACTTACAAGCAGCATTTCG
AGAACAAGCATCCCAAGAATGACATGCCCGATGAGCTGAAGGAGGTCTGA
AAGCTTTCTAGACC

BS16065.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:33:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG18081-PA 234 CG18081-RA 1..234 17..250 1170 100 Plus
CG15715-PA 234 CG15715-RA 1..234 17..250 945 96.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 20:59:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG18081-RC 717 CG18081-RC 198..431 17..250 1170 100 Plus
CG18081-RB 886 CG18081-RB 86..319 17..250 1170 100 Plus
CG18081-RA 721 CG18081-RA 202..435 17..250 1170 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 20:59:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15834734..15834877 160..17 720 100 Minus
3L 28110227 3L 15836780..15836923 160..17 705 99.3 Minus
3L 28110227 3L 15834362..15834453 250..159 460 100 Minus
3L 28110227 3L 15836159..15836250 250..159 340 91.3 Minus
Blast to na_te.dros performed 2015-02-10 20:59:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 1443..1488 92..137 104 69.6 Plus

BS16065.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:48 Download gff for BS16065.5prime
Subject Subject Range Query Range Percent Splice Strand
CG18081-PA 1..234 17..250 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 13:59:11 Download gff for BS16065.5prime
Subject Subject Range Query Range Percent Splice Strand
CG18081-RA 196..435 9..250 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:39:04 Download gff for BS16065.5prime
Subject Subject Range Query Range Percent Splice Strand
CG18081-RA 196..435 9..250 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:39:04 Download gff for BS16065.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 15834362..15834451 161..250 100 <- Minus
3L 15834734..15834883 9..160 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 13:59:11 Download gff for BS16065.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15827462..15827551 161..250 100 <- Minus
arm_3L 15827834..15827983 9..160 97   Minus

BS16065.3prime Sequence

264 bp (264 high quality bases) assembled on 2007-04-16

> BS16065.3prime
ATGGTCTAGAAAGCTTTCACACCTCCTTCAGCTCATCGGGCATGTCATTC
TTGGGATGCTTGTTCTCGAAATGCTGCTTGTAAGTCTTCGGATCGGGCAT
TTGCGACTTGCAAACGGCGCACACATAGACAAGTGCCTTCTGGGCCGCCT
TCTTCTGGTCGTTGGCACTGTGTCCTTGTTGCTTCTTTAGTTTGGCCTGC
TTCTCGGAGGCCTTCGCCTGCGACTGGATCTTCTGGTGTCCACGTGCCAT
GTCGACTGATAACT

BS16065.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:32:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG18081-PA 234 CG18081-RA 1..230 250..21 1150 100 Minus
CG15715-PA 234 CG15715-RA 1..230 250..21 925 96 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 20:59:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG18081-RC 717 CG18081-RC 198..431 250..17 1155 99.6 Minus
CG18081-RB 886 CG18081-RB 86..319 250..17 1155 99.6 Minus
CG18081-RA 721 CG18081-RA 202..435 250..17 1155 99.6 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 20:59:45
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15834734..15834877 107..250 720 100 Plus
3L 28110227 3L 15836780..15836923 107..250 705 99.3 Plus
3L 28110227 3L 15834362..15834453 17..108 445 98.9 Plus
3L 28110227 3L 15836159..15836250 17..108 325 90.2 Plus
Blast to na_te.dros performed 2015-02-10 20:59:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 1443..1488 175..130 104 69.6 Minus

BS16065.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:48 Download gff for BS16065.3prime
Subject Subject Range Query Range Percent Splice Strand
CG18081-PA 1..234 17..250 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 13:59:09 Download gff for BS16065.3prime
Subject Subject Range Query Range Percent Splice Strand
CG18081-RA 196..435 17..258 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:39:02 Download gff for BS16065.3prime
Subject Subject Range Query Range Percent Splice Strand
CG18081-RA 196..435 17..258 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:39:02 Download gff for BS16065.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 15834362..15834451 17..106 98 <- Plus
3L 15834734..15834883 107..258 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 13:59:09 Download gff for BS16065.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15827462..15827551 17..106 98 <- Plus
arm_3L 15827834..15827983 107..258 97   Plus

BS16065.complete Sequence

266 bp assembled on 2007-05-07

GenBank Submission: FJ638046

> BS16065.complete
GAAGTTATCAGTCGACATGGCACGTGGACACCAGAAGATCCAGTCGCAGG
CGAAGGCCTCCGAGAAGCAGGCCAAACTAAAGAAGCAACAAGGACACAGT
GCCAACGACCAGAAGAAGGCGGCCCAGAAGGCACTTGTCTATGTGTGCGC
CGTTTGCAAGTCGCAAATGCCCGATCCGAAGACTTACAAGCAGCATTTCG
AGAACAAGCATCCCAAGAATGACATGCCCGATGAGCTGAAGGAGGTCTGA
AAGCTTTCTAGACCAT

BS16065.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:21:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG18081-RC 234 CG18081-PC 1..234 17..250 1170 100 Plus
CG18081-RB 234 CG18081-PB 1..234 17..250 1170 100 Plus
CG18081-RA 234 CG18081-PA 1..234 17..250 1170 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:21:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG18081-RC 717 CG18081-RC 198..431 17..250 1170 100 Plus
CG18081-RB 886 CG18081-RB 86..319 17..250 1170 100 Plus
CG18081-RA 721 CG18081-RA 202..435 17..250 1170 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:21:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15834734..15834877 160..17 720 100 Minus
3L 28110227 3L 15836780..15836923 160..17 705 99.3 Minus
3L 28110227 3L 15834362..15834453 250..159 460 100 Minus
3L 28110227 3L 15836159..15836250 250..159 340 91.3 Minus
Blast to na_te.dros performed 2014-11-27 07:21:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 1443..1488 92..137 104 69.6 Plus

BS16065.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:20:14 Download gff for BS16065.complete
Subject Subject Range Query Range Percent Splice Strand
CG18081-RA 1..234 17..250 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:01:23 Download gff for BS16065.complete
Subject Subject Range Query Range Percent Splice Strand
CG18081-RA 194..433 9..250 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:12:54 Download gff for BS16065.complete
Subject Subject Range Query Range Percent Splice Strand
CG18081-RA 202..434 17..249 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:20:14 Download gff for BS16065.complete
Subject Subject Range Query Range Percent Splice Strand
CG18081-RA 194..433 9..250 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:08:55 Download gff for BS16065.complete
Subject Subject Range Query Range Percent Splice Strand
CG18081-RA 202..434 17..249 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:08:55 Download gff for BS16065.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15834363..15834451 161..249 100 <- Minus
3L 15834734..15834877 17..160 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:12:54 Download gff for BS16065.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15827463..15827551 161..249 100 <- Minus
arm_3L 15827834..15827977 17..160 100   Minus

BS16065.pep Sequence

Translation from 16 to 249

> BS16065.pep
MARGHQKIQSQAKASEKQAKLKKQQGHSANDQKKAAQKALVYVCAVCKSQ
MPDPKTYKQHFENKHPKNDMPDELKEV*

BS16065.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:51:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG18081-PC 77 CG18081-PC 1..77 1..77 406 100 Plus
CG18081-PB 77 CG18081-PB 1..77 1..77 406 100 Plus
CG18081-PA 77 CG18081-PA 1..77 1..77 406 100 Plus
CG15715-PB 77 CG15715-PB 1..77 1..77 398 97.4 Plus
CG15715-PA 77 CG15715-PA 1..77 1..77 398 97.4 Plus