Associations are from manual ordering of a clone or by a periodic analysis.
Clone Sequence Records
BS16065.5prime Sequence
264 bp (264 high quality bases) assembled on 2007-04-16
> BS16065.5prime
GAAGTTATCAGTCGACATGGCACGTGGACACCAGAAGATCCAGTCGCAGG
CGAAGGCCTCCGAGAAGCAGGCCAAACTAAAGAAGCAACAAGGACACAGT
GCCAACGACCAGAAGAAGGCGGCCCAGAAGGCACTTGTCTATGTGTGCGC
CGTTTGCAAGTCGCAAATGCCCGATCCGAAGACTTACAAGCAGCATTTCG
AGAACAAGCATCCCAAGAATGACATGCCCGATGAGCTGAAGGAGGTCTGA
AAGCTTTCTAGACC
BS16065.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:33:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18081-PA | 234 | CG18081-RA | 1..234 | 17..250 | 1170 | 100 | Plus |
CG15715-PA | 234 | CG15715-RA | 1..234 | 17..250 | 945 | 96.1 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 20:59:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18081-RC | 717 | CG18081-RC | 198..431 | 17..250 | 1170 | 100 | Plus |
CG18081-RB | 886 | CG18081-RB | 86..319 | 17..250 | 1170 | 100 | Plus |
CG18081-RA | 721 | CG18081-RA | 202..435 | 17..250 | 1170 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 20:59:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 15834734..15834877 | 160..17 | 720 | 100 | Minus |
3L | 28110227 | 3L | 15836780..15836923 | 160..17 | 705 | 99.3 | Minus |
3L | 28110227 | 3L | 15834362..15834453 | 250..159 | 460 | 100 | Minus |
3L | 28110227 | 3L | 15836159..15836250 | 250..159 | 340 | 91.3 | Minus |
Blast to na_te.dros performed 2015-02-10 20:59:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmer\R1A3 | 3772 | Dmer\R1A3 MERCR1A3 3772bp | 1443..1488 | 92..137 | 104 | 69.6 | Plus |
BS16065.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:48 Download gff for
BS16065.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18081-PA | 1..234 | 17..250 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 13:59:11 Download gff for
BS16065.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18081-RA | 196..435 | 9..250 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:39:04 Download gff for
BS16065.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18081-RA | 196..435 | 9..250 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:39:04 Download gff for
BS16065.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 15834362..15834451 | 161..250 | 100 | <- | Minus |
3L | 15834734..15834883 | 9..160 | 97 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 13:59:11 Download gff for
BS16065.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 15827462..15827551 | 161..250 | 100 | <- | Minus |
arm_3L | 15827834..15827983 | 9..160 | 97 | | Minus |
BS16065.3prime Sequence
264 bp (264 high quality bases) assembled on 2007-04-16
> BS16065.3prime
ATGGTCTAGAAAGCTTTCACACCTCCTTCAGCTCATCGGGCATGTCATTC
TTGGGATGCTTGTTCTCGAAATGCTGCTTGTAAGTCTTCGGATCGGGCAT
TTGCGACTTGCAAACGGCGCACACATAGACAAGTGCCTTCTGGGCCGCCT
TCTTCTGGTCGTTGGCACTGTGTCCTTGTTGCTTCTTTAGTTTGGCCTGC
TTCTCGGAGGCCTTCGCCTGCGACTGGATCTTCTGGTGTCCACGTGCCAT
GTCGACTGATAACT
BS16065.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:32:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18081-PA | 234 | CG18081-RA | 1..230 | 250..21 | 1150 | 100 | Minus |
CG15715-PA | 234 | CG15715-RA | 1..230 | 250..21 | 925 | 96 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 20:59:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18081-RC | 717 | CG18081-RC | 198..431 | 250..17 | 1155 | 99.6 | Minus |
CG18081-RB | 886 | CG18081-RB | 86..319 | 250..17 | 1155 | 99.6 | Minus |
CG18081-RA | 721 | CG18081-RA | 202..435 | 250..17 | 1155 | 99.6 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 20:59:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 15834734..15834877 | 107..250 | 720 | 100 | Plus |
3L | 28110227 | 3L | 15836780..15836923 | 107..250 | 705 | 99.3 | Plus |
3L | 28110227 | 3L | 15834362..15834453 | 17..108 | 445 | 98.9 | Plus |
3L | 28110227 | 3L | 15836159..15836250 | 17..108 | 325 | 90.2 | Plus |
Blast to na_te.dros performed 2015-02-10 20:59:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmer\R1A3 | 3772 | Dmer\R1A3 MERCR1A3 3772bp | 1443..1488 | 175..130 | 104 | 69.6 | Minus |
BS16065.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:48 Download gff for
BS16065.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18081-PA | 1..234 | 17..250 | 99 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 13:59:09 Download gff for
BS16065.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18081-RA | 196..435 | 17..258 | 97 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:39:02 Download gff for
BS16065.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18081-RA | 196..435 | 17..258 | 97 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:39:02 Download gff for
BS16065.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 15834362..15834451 | 17..106 | 98 | <- | Plus |
3L | 15834734..15834883 | 107..258 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 13:59:09 Download gff for
BS16065.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 15827462..15827551 | 17..106 | 98 | <- | Plus |
arm_3L | 15827834..15827983 | 107..258 | 97 | | Plus |
BS16065.complete Sequence
266 bp assembled on 2007-05-07
GenBank Submission: FJ638046
> BS16065.complete
GAAGTTATCAGTCGACATGGCACGTGGACACCAGAAGATCCAGTCGCAGG
CGAAGGCCTCCGAGAAGCAGGCCAAACTAAAGAAGCAACAAGGACACAGT
GCCAACGACCAGAAGAAGGCGGCCCAGAAGGCACTTGTCTATGTGTGCGC
CGTTTGCAAGTCGCAAATGCCCGATCCGAAGACTTACAAGCAGCATTTCG
AGAACAAGCATCCCAAGAATGACATGCCCGATGAGCTGAAGGAGGTCTGA
AAGCTTTCTAGACCAT
BS16065.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:21:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18081-RC | 234 | CG18081-PC | 1..234 | 17..250 | 1170 | 100 | Plus |
CG18081-RB | 234 | CG18081-PB | 1..234 | 17..250 | 1170 | 100 | Plus |
CG18081-RA | 234 | CG18081-PA | 1..234 | 17..250 | 1170 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:21:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18081-RC | 717 | CG18081-RC | 198..431 | 17..250 | 1170 | 100 | Plus |
CG18081-RB | 886 | CG18081-RB | 86..319 | 17..250 | 1170 | 100 | Plus |
CG18081-RA | 721 | CG18081-RA | 202..435 | 17..250 | 1170 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:21:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 15834734..15834877 | 160..17 | 720 | 100 | Minus |
3L | 28110227 | 3L | 15836780..15836923 | 160..17 | 705 | 99.3 | Minus |
3L | 28110227 | 3L | 15834362..15834453 | 250..159 | 460 | 100 | Minus |
3L | 28110227 | 3L | 15836159..15836250 | 250..159 | 340 | 91.3 | Minus |
Blast to na_te.dros performed 2014-11-27 07:21:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmer\R1A3 | 3772 | Dmer\R1A3 MERCR1A3 3772bp | 1443..1488 | 92..137 | 104 | 69.6 | Plus |
BS16065.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:20:14 Download gff for
BS16065.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18081-RA | 1..234 | 17..250 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:01:23 Download gff for
BS16065.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18081-RA | 194..433 | 9..250 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:12:54 Download gff for
BS16065.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18081-RA | 202..434 | 17..249 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:20:14 Download gff for
BS16065.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18081-RA | 194..433 | 9..250 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:08:55 Download gff for
BS16065.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18081-RA | 202..434 | 17..249 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:08:55 Download gff for
BS16065.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 15834363..15834451 | 161..249 | 100 | <- | Minus |
3L | 15834734..15834877 | 17..160 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:12:54 Download gff for
BS16065.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 15827463..15827551 | 161..249 | 100 | <- | Minus |
arm_3L | 15827834..15827977 | 17..160 | 100 | | Minus |
BS16065.pep Sequence
Translation from 16 to 249
> BS16065.pep
MARGHQKIQSQAKASEKQAKLKKQQGHSANDQKKAAQKALVYVCAVCKSQ
MPDPKTYKQHFENKHPKNDMPDELKEV*
BS16065.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:51:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18081-PC | 77 | CG18081-PC | 1..77 | 1..77 | 406 | 100 | Plus |
CG18081-PB | 77 | CG18081-PB | 1..77 | 1..77 | 406 | 100 | Plus |
CG18081-PA | 77 | CG18081-PA | 1..77 | 1..77 | 406 | 100 | Plus |
CG15715-PB | 77 | CG15715-PB | 1..77 | 1..77 | 398 | 97.4 | Plus |
CG15715-PA | 77 | CG15715-PA | 1..77 | 1..77 | 398 | 97.4 | Plus |