Clone Sequence Records
BS16073.3prime Sequence
216 bp (216 high quality bases) assembled on 2007-04-16
> BS16073.3prime
ATGGTCTAGAAAGCTTCTAGGATTCCGATTGGGTTTGACGCTGAGCTGGC
TTGCCATTTGCCCAGGGAGTGAACTTCACATGGCTCGCGTCGCGCTTGGC
GGCATCCGCACGCAGTCCCGTCTTCAAGGACTCGCGCAAAATGCGAGCGG
CGATGTTGGAGTATTGGATGTAGGTAATTCCGGCAGCTCTCCAGGCAGTC
ATGTCGACTGATAACT
BS16073.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:34:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9032-PA | 186 | sun-RA | 1..186 | 202..17 | 930 | 100 | Minus |
CG9032-PB | 174 | sun-RB | 1..161 | 202..42 | 805 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 15:38:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
sun-RA | 400 | CG9032-RA | 95..287 | 202..10 | 950 | 99.5 | Minus |
sun-RB | 450 | CG9032-RB | 95..255 | 202..42 | 805 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 15:38:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 15848886..15849016 | 43..173 | 655 | 100 | Plus |
3R | 32079331 | 3R | 10122032..10122180 | 196..48 | 190 | 75.2 | Minus |
Blast to na_te.dros performed on 2015-02-10 15:38:28 has no hits.
BS16073.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:53 Download gff for
BS16073.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9032-PA | 1..186 | 17..202 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 06:55:30 Download gff for
BS16073.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
sun-RA | 89..287 | 10..212 | 97 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:26:30 Download gff for
BS16073.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
sun-RA | 89..287 | 10..212 | 97 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:26:30 Download gff for
BS16073.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 15847972..15848004 | 10..42 | 96 | <- | Plus |
X | 15848886..15849016 | 43..173 | 100 | <- | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 06:55:30 Download gff for
BS16073.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 15742005..15742037 | 10..42 | 96 | <- | Plus |
arm_X | 15742919..15743049 | 43..173 | 100 | <- | Plus |
BS16073.5prime Sequence
216 bp (216 high quality bases) assembled on 2007-04-16
> BS16073.5prime
GAAGTTATCAGTCGACATGACTGCCTGGAGAGCTGCCGGAATTACCTACA
TCCAATACTCCAACATCGCCGCTCGCATTTTGCGCGAGTCCTTGAAGACG
GGACTGCGTGCGGATGCCGCCAAGCGCGACGCGAGCCATGTGAAGTTCAC
TCCCTGGGCAAATGGCAAGCCAGCTCAGCGTCAAACCCAATCGGAATCCT
AGAAGCTTTCTAGACC
BS16073.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:34:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9032-PA | 186 | sun-RA | 1..186 | 17..202 | 930 | 100 | Plus |
CG9032-PB | 174 | sun-RB | 1..161 | 17..177 | 805 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-05 02:30:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
sun-RA | 400 | CG9032-RA | 95..287 | 17..209 | 950 | 99.5 | Plus |
sun-RB | 450 | CG9032-RB | 95..255 | 17..177 | 805 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-05 02:30:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 15848886..15849016 | 176..46 | 655 | 100 | Minus |
3R | 32079331 | 3R | 10122032..10122180 | 23..171 | 190 | 75.2 | Plus |
Blast to na_te.dros performed on 2015-02-05 02:30:08 has no hits.
BS16073.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:53 Download gff for
BS16073.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9032-PA | 1..186 | 17..202 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-10 22:13:00 Download gff for
BS16073.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
sun-RA | 89..287 | 7..209 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-05 03:06:39 Download gff for
BS16073.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
sun-RA | 89..287 | 7..209 | 97 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-05 03:06:39 Download gff for
BS16073.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 15847972..15848004 | 177..209 | 96 | <- | Minus |
X | 15848886..15849016 | 46..176 | 100 | <- | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-10 22:13:00 Download gff for
BS16073.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 15742005..15742037 | 177..209 | 96 | <- | Minus |
arm_X | 15742919..15743049 | 46..176 | 100 | <- | Minus |
BS16073.complete Sequence
218 bp assembled on 2007-05-07
GenBank Submission: FJ638050
> BS16073.complete
GAAGTTATCAGTCGACATGACTGCCTGGAGAGCTGCCGGAATTACCTACA
TCCAATACTCCAACATCGCCGCTCGCATTTTGCGCGAGTCCTTGAAGACG
GGACTGCGTGCGGATGCCGCCAAGCGCGACGCGAGCCATGTGAAGTTCAC
TCCCTGGGCAAATGGCAAGCCAGCTCAGCGTCAAACCCAATCGGAATCCT
AGAAGCTTTCTAGACCAT
BS16073.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:22:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
sun-RA | 186 | CG9032-PA | 1..186 | 17..202 | 930 | 100 | Plus |
sun-RB | 174 | CG9032-PB | 1..161 | 17..177 | 805 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:22:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
sun-RA | 400 | CG9032-RA | 95..287 | 17..209 | 950 | 99.5 | Plus |
sun-RB | 450 | CG9032-RB | 95..255 | 17..177 | 805 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:21:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 15848886..15849016 | 176..46 | 655 | 100 | Minus |
3R | 32079331 | 3R | 10122032..10122180 | 23..171 | 190 | 75.2 | Plus |
Blast to na_te.dros performed on 2014-11-27 15:22:00 has no hits.
BS16073.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:49:45 Download gff for
BS16073.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
sun-RA | 1..186 | 17..202 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:38:16 Download gff for
BS16073.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
sun-RA | 71..269 | 7..209 | 97 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:50:10 Download gff for
BS16073.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
sun-RA | 95..280 | 17..202 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:49:45 Download gff for
BS16073.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
sun-RA | 71..269 | 7..209 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:06:00 Download gff for
BS16073.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
sun-RA | 95..280 | 17..202 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:06:00 Download gff for
BS16073.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 15847979..15848004 | 177..202 | 100 | <- | Minus |
X | 15848886..15849016 | 46..176 | 100 | <- | Minus |
X | 15849136..15849164 | 17..45 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:50:10 Download gff for
BS16073.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 15742012..15742037 | 177..202 | 100 | <- | Minus |
arm_X | 15742919..15743049 | 46..176 | 100 | <- | Minus |
arm_X | 15743169..15743197 | 17..45 | 100 | | Minus |
BS16073.pep Sequence
Translation from 16 to 201
> BS16073.pep
MTAWRAAGITYIQYSNIAARILRESLKTGLRADAAKRDASHVKFTPWANG
KPAQRQTQSES*
BS16073.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 03:02:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
sun-PA | 61 | CG9032-PA | 1..61 | 1..61 | 312 | 100 | Plus |
sun-PB | 57 | CG9032-PB | 1..56 | 1..56 | 275 | 94.6 | Plus |
CG31477-PC | 64 | CG31477-PC | 1..64 | 1..61 | 221 | 68.8 | Plus |
CG31477-PB | 64 | CG31477-PB | 1..64 | 1..61 | 221 | 68.8 | Plus |
CG31477-PA | 64 | CG31477-PA | 1..64 | 1..61 | 221 | 68.8 | Plus |