Clone BS16073 Report

Search the DGRC for BS16073

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:160
Well:73
Vector:pDNR-Dual
Associated Gene/Transcriptsun-RA
Protein status:BS16073.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS16073.3prime Sequence

216 bp (216 high quality bases) assembled on 2007-04-16

> BS16073.3prime
ATGGTCTAGAAAGCTTCTAGGATTCCGATTGGGTTTGACGCTGAGCTGGC
TTGCCATTTGCCCAGGGAGTGAACTTCACATGGCTCGCGTCGCGCTTGGC
GGCATCCGCACGCAGTCCCGTCTTCAAGGACTCGCGCAAAATGCGAGCGG
CGATGTTGGAGTATTGGATGTAGGTAATTCCGGCAGCTCTCCAGGCAGTC
ATGTCGACTGATAACT

BS16073.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:34:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG9032-PA 186 sun-RA 1..186 202..17 930 100 Minus
CG9032-PB 174 sun-RB 1..161 202..42 805 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 15:38:31
Subject Length Description Subject Range Query Range Score Percent Strand
sun-RA 400 CG9032-RA 95..287 202..10 950 99.5 Minus
sun-RB 450 CG9032-RB 95..255 202..42 805 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 15:38:24
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15848886..15849016 43..173 655 100 Plus
3R 32079331 3R 10122032..10122180 196..48 190 75.2 Minus
Blast to na_te.dros performed on 2015-02-10 15:38:28 has no hits.

BS16073.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:53 Download gff for BS16073.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9032-PA 1..186 17..202 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 06:55:30 Download gff for BS16073.3prime
Subject Subject Range Query Range Percent Splice Strand
sun-RA 89..287 10..212 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:26:30 Download gff for BS16073.3prime
Subject Subject Range Query Range Percent Splice Strand
sun-RA 89..287 10..212 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:26:30 Download gff for BS16073.3prime
Subject Subject Range Query Range Percent Splice Strand
X 15847972..15848004 10..42 96 <- Plus
X 15848886..15849016 43..173 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 06:55:30 Download gff for BS16073.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 15742005..15742037 10..42 96 <- Plus
arm_X 15742919..15743049 43..173 100 <- Plus

BS16073.5prime Sequence

216 bp (216 high quality bases) assembled on 2007-04-16

> BS16073.5prime
GAAGTTATCAGTCGACATGACTGCCTGGAGAGCTGCCGGAATTACCTACA
TCCAATACTCCAACATCGCCGCTCGCATTTTGCGCGAGTCCTTGAAGACG
GGACTGCGTGCGGATGCCGCCAAGCGCGACGCGAGCCATGTGAAGTTCAC
TCCCTGGGCAAATGGCAAGCCAGCTCAGCGTCAAACCCAATCGGAATCCT
AGAAGCTTTCTAGACC

BS16073.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:34:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG9032-PA 186 sun-RA 1..186 17..202 930 100 Plus
CG9032-PB 174 sun-RB 1..161 17..177 805 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-05 02:30:10
Subject Length Description Subject Range Query Range Score Percent Strand
sun-RA 400 CG9032-RA 95..287 17..209 950 99.5 Plus
sun-RB 450 CG9032-RB 95..255 17..177 805 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-05 02:30:05
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15848886..15849016 176..46 655 100 Minus
3R 32079331 3R 10122032..10122180 23..171 190 75.2 Plus
Blast to na_te.dros performed on 2015-02-05 02:30:08 has no hits.

BS16073.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:53 Download gff for BS16073.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9032-PA 1..186 17..202 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-10 22:13:00 Download gff for BS16073.5prime
Subject Subject Range Query Range Percent Splice Strand
sun-RA 89..287 7..209 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-05 03:06:39 Download gff for BS16073.5prime
Subject Subject Range Query Range Percent Splice Strand
sun-RA 89..287 7..209 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-05 03:06:39 Download gff for BS16073.5prime
Subject Subject Range Query Range Percent Splice Strand
X 15847972..15848004 177..209 96 <- Minus
X 15848886..15849016 46..176 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-10 22:13:00 Download gff for BS16073.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 15742005..15742037 177..209 96 <- Minus
arm_X 15742919..15743049 46..176 100 <- Minus

BS16073.complete Sequence

218 bp assembled on 2007-05-07

GenBank Submission: FJ638050

> BS16073.complete
GAAGTTATCAGTCGACATGACTGCCTGGAGAGCTGCCGGAATTACCTACA
TCCAATACTCCAACATCGCCGCTCGCATTTTGCGCGAGTCCTTGAAGACG
GGACTGCGTGCGGATGCCGCCAAGCGCGACGCGAGCCATGTGAAGTTCAC
TCCCTGGGCAAATGGCAAGCCAGCTCAGCGTCAAACCCAATCGGAATCCT
AGAAGCTTTCTAGACCAT

BS16073.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:22:00
Subject Length Description Subject Range Query Range Score Percent Strand
sun-RA 186 CG9032-PA 1..186 17..202 930 100 Plus
sun-RB 174 CG9032-PB 1..161 17..177 805 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:22:02
Subject Length Description Subject Range Query Range Score Percent Strand
sun-RA 400 CG9032-RA 95..287 17..209 950 99.5 Plus
sun-RB 450 CG9032-RB 95..255 17..177 805 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:21:59
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15848886..15849016 176..46 655 100 Minus
3R 32079331 3R 10122032..10122180 23..171 190 75.2 Plus
Blast to na_te.dros performed on 2014-11-27 15:22:00 has no hits.

BS16073.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:49:45 Download gff for BS16073.complete
Subject Subject Range Query Range Percent Splice Strand
sun-RA 1..186 17..202 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:38:16 Download gff for BS16073.complete
Subject Subject Range Query Range Percent Splice Strand
sun-RA 71..269 7..209 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:50:10 Download gff for BS16073.complete
Subject Subject Range Query Range Percent Splice Strand
sun-RA 95..280 17..202 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:49:45 Download gff for BS16073.complete
Subject Subject Range Query Range Percent Splice Strand
sun-RA 71..269 7..209 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:06:00 Download gff for BS16073.complete
Subject Subject Range Query Range Percent Splice Strand
sun-RA 95..280 17..202 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:06:00 Download gff for BS16073.complete
Subject Subject Range Query Range Percent Splice Strand
X 15847979..15848004 177..202 100 <- Minus
X 15848886..15849016 46..176 100 <- Minus
X 15849136..15849164 17..45 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:50:10 Download gff for BS16073.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15742012..15742037 177..202 100 <- Minus
arm_X 15742919..15743049 46..176 100 <- Minus
arm_X 15743169..15743197 17..45 100   Minus

BS16073.pep Sequence

Translation from 16 to 201

> BS16073.pep
MTAWRAAGITYIQYSNIAARILRESLKTGLRADAAKRDASHVKFTPWANG
KPAQRQTQSES*

BS16073.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 03:02:26
Subject Length Description Subject Range Query Range Score Percent Strand
sun-PA 61 CG9032-PA 1..61 1..61 312 100 Plus
sun-PB 57 CG9032-PB 1..56 1..56 275 94.6 Plus
CG31477-PC 64 CG31477-PC 1..64 1..61 221 68.8 Plus
CG31477-PB 64 CG31477-PB 1..64 1..61 221 68.8 Plus
CG31477-PA 64 CG31477-PA 1..64 1..61 221 68.8 Plus