Clone BS16111 Report

Search the DGRC for BS16111

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:161
Well:11
Vector:pDNR-Dual
Associated Gene/TranscriptCG9877-RA
Protein status:BS16111.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS16111.3prime Sequence

297 bp (297 high quality bases) assembled on 2007-04-16

> BS16111.3prime
ATGGTCTAGAAAGCGTCTATCCGTAGAAGCCACCGCCGAATCCGCCAGCG
GAGGCCGAGGACGAGGCCGAGGCACTGGCTCCGCCGAATCCGCCGCGCCT
AAAGCCACCGTAGCCAGGATATCCGCCACCGAAGCCGCCGTAGCCAGGAT
ATCCGCCTCCGAATCCGCCGTATCCGGGGTATCCGCCTCCGAAGCCACCA
TATCCGAACTGGGGAGCGGGCACGGCCTCCAGGACACTGAGGAGTGCGAA
AATCACAACGACAAACACGATAGCAGCTCGCATGTCGACTGATAACT

BS16111.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:41:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG9877-PA 267 CG9877-RA 1..267 283..17 1335 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 23:10:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG9877-RA 388 CG9877-RA 52..319 283..16 1340 100 Minus
CG9877-RA 388 CG9877-RA 129..203 176..102 240 88 Minus
CG9877-RA 388 CG9877-RA 159..233 206..132 240 88 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 23:10:33
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23085950..23086217 16..283 1340 100 Plus
2R 25286936 2R 23086036..23086110 132..206 240 88 Plus
2R 25286936 2R 23086066..23086140 102..176 240 88 Plus
Blast to na_te.dros performed on 2015-02-11 23:10:36 has no hits.

BS16111.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:02:13 Download gff for BS16111.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9877-PA 1..267 17..283 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 04:44:47 Download gff for BS16111.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9877-RA 44..319 16..291 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:37:53 Download gff for BS16111.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9877-RA 44..319 16..291 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 01:37:53 Download gff for BS16111.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 23085950..23086225 16..291 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 04:44:47 Download gff for BS16111.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18973473..18973748 16..291 98   Plus

BS16111.5prime Sequence

297 bp (297 high quality bases) assembled on 2007-04-16

> BS16111.5prime
GAAGTTATCAGTCGACATGCGAGCTGCTATCGTGTTTGTCGTTGTGATTT
TCGCACTCCTCAGTGTCCTGGAGGCCGTGCCCGCTCCCCAGTTCGGATAT
GGTGGCTTCGGAGGCGGATACCCCGGATACGGCGGATTCGGAGGCGGATA
TCCTGGCTACGGCGGCTTCGGTGGCGGATATCCTGGCTACGGTGGCTTTA
GGCGCGGCGGATTCGGCGGAGCCAGTGCCTCGGCCTCGTCCTCGGCCTCC
GCTGGCGGATTCGGCGGTGGCTTCTACGGATAGAAGCTTTCTAGACC

BS16111.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:41:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG9877-PA 267 CG9877-RA 1..267 17..283 1335 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 04:40:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG9877-RA 388 CG9877-RA 52..320 17..285 1345 100 Plus
CG9877-RA 388 CG9877-RA 129..203 124..198 240 88 Plus
CG9877-RA 388 CG9877-RA 159..233 94..168 240 88 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 04:39:57
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23085949..23086217 285..17 1345 100 Minus
2R 25286936 2R 23086036..23086110 168..94 240 88 Minus
2R 25286936 2R 23086066..23086140 198..124 240 88 Minus
Blast to na_te.dros performed on 2015-02-11 04:39:59 has no hits.

BS16111.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:02:13 Download gff for BS16111.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9877-PA 1..267 17..283 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 09:11:40 Download gff for BS16111.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9877-RA 44..320 9..285 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:12:22 Download gff for BS16111.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9877-RA 44..320 9..285 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 09:12:22 Download gff for BS16111.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 23085949..23086225 9..285 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 09:11:40 Download gff for BS16111.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18973472..18973748 9..285 98   Minus

BS16111.complete Sequence

299 bp assembled on 2007-05-07

GenBank Submission: FJ638062

> BS16111.complete
GAAGTTATCAGTCGACATGCGAGCTGCTATCGTGTTTGTCGTTGTGATTT
TCGCACTCCTCAGTGTCCTGGAGGCCGTGCCCGCTCCCCAGTTCGGATAT
GGTGGCTTCGGAGGCGGATACCCCGGATACGGCGGATTCGGAGGCGGATA
TCCTGGCTACGGCGGCTTCGGTGGCGGATATCCTGGCTACGGTGGCTTTA
GGCGCGGCGGATTCGGCGGAGCCAGTGCCTCGGCCTCGTCCTCGGCCTCC
GCTGGCGGATTCGGCGGTGGCTTCTACGGATAGAAGCTTTCTAGACCAT

BS16111.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:54:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG9877-RA 267 CG9877-PA 1..267 17..283 1335 100 Plus
CG9877-RA 267 CG9877-PA 78..152 124..198 240 88 Plus
CG9877-RA 267 CG9877-PA 108..182 94..168 240 88 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:54:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG9877-RA 388 CG9877-RA 52..320 17..285 1345 100 Plus
CG9877-RA 388 CG9877-RA 129..203 124..198 240 88 Plus
CG9877-RA 388 CG9877-RA 159..233 94..168 240 88 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:54:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23085949..23086217 285..17 1345 100 Minus
2R 25286936 2R 23086036..23086110 168..94 240 88 Minus
2R 25286936 2R 23086066..23086140 198..124 240 88 Minus
Blast to na_te.dros performed on 2014-11-27 13:54:12 has no hits.

BS16111.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:49:41 Download gff for BS16111.complete
Subject Subject Range Query Range Percent Splice Strand
CG9877-RA 1..267 17..283 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:38:04 Download gff for BS16111.complete
Subject Subject Range Query Range Percent Splice Strand
CG9877-RA 37..313 9..285 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:35:09 Download gff for BS16111.complete
Subject Subject Range Query Range Percent Splice Strand
CG9877-RA 52..318 17..283 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:49:41 Download gff for BS16111.complete
Subject Subject Range Query Range Percent Splice Strand
CG9877-RA 37..313 9..285 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:29:20 Download gff for BS16111.complete
Subject Subject Range Query Range Percent Splice Strand
CG9877-RA 52..318 17..283 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:29:20 Download gff for BS16111.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23085951..23086217 17..283 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:35:09 Download gff for BS16111.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18973474..18973740 17..283 100   Minus

BS16111.pep Sequence

Translation from 16 to 282

> BS16111.pep
MRAAIVFVVVIFALLSVLEAVPAPQFGYGGFGGGYPGYGGFGGGYPGYGG
FGGGYPGYGGFRRGGFGGASASASSSASAGGFGGGFYG*

BS16111.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:42:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG9877-PA 88 CG9877-PA 1..88 1..88 479 100 Plus
CG8157-PB 113 CG8157-PB 1..88 1..88 175 44.4 Plus
CG8157-PA 113 CG8157-PA 1..88 1..88 175 44.4 Plus
CG7294-PA 127 CG7294-PA 4..108 8..85 170 44.8 Plus
Listericin-PA 121 CG9080-PA 55..119 26..84 169 61.5 Plus
CG7294-PA 127 CG7294-PA 49..127 26..88 134 44.3 Plus
CG8157-PB 113 CG8157-PB 49..111 27..88 132 51.4 Plus
CG8157-PA 113 CG8157-PA 49..111 27..88 132 51.4 Plus