Clone BS16112 Report

Search the DGRC for BS16112

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:161
Well:12
Vector:pDNR-Dual
Associated Gene/TranscriptCG15282-RA
Protein status:BS16112.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS16112.3prime Sequence

270 bp (270 high quality bases) assembled on 2007-04-16

> BS16112.3prime
ATGGTCTAGAAAGCTTTTACAAGAAGCCTCCTTGTTGCTGCTGCTGCTGC
TGCTCGATTCCTCCAAATCCGCCGAATCCACCGAAGCTTTCCTGCTGCTG
TTGCTGTTCTCCGAAGCCTCCGAAACCGCCGAATCCTTCTTGCTGCTGCT
GTTGGCCACCGAATCCTCCGAATCCACCGAATCCTCCATATCCGAATTGA
GGAAGCGCGGAAGCAACGGCGATAAGGGCCACAAAAACGATCACCAAGAA
TTTCATGTCGACTGATAACT

BS16112.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:41:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG15282-PA 240 CG15282-RA 1..236 256..21 1180 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 19:10:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG15282-RB 383 CG15282-RB 78..317 256..17 1185 99.6 Minus
CG15282-RC 521 CG15282-RC 216..455 256..17 1185 99.6 Minus
CG15282-RA 563 CG15282-RA 78..317 256..17 1185 99.6 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 19:10:34
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 14712824..14713052 245..17 1130 99.6 Minus
Blast to na_te.dros performed on 2015-02-11 19:10:36 has no hits.

BS16112.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:02:14 Download gff for BS16112.3prime
Subject Subject Range Query Range Percent Splice Strand
CG15282-PA 1..240 17..256 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-27 05:12:06 Download gff for BS16112.3prime
Subject Subject Range Query Range Percent Splice Strand
CG15282-RA 73..325 7..261 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 00:07:49 Download gff for BS16112.3prime
Subject Subject Range Query Range Percent Splice Strand
CG15282-RA 73..325 7..261 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 00:07:49 Download gff for BS16112.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 14712819..14713060 7..251 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-27 05:12:06 Download gff for BS16112.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 14712819..14713060 7..251 97   Minus

BS16112.5prime Sequence

271 bp (271 high quality bases) assembled on 2007-04-16

> BS16112.5prime
GAAGTGTATCCTTCGACATGAAATTCTTGGTGATCGTTTTTGTGGCCCTT
ATCGCCGTTGCTTCCGCGCTTCCTCAATTCGGATATGGAGGATTCGGTGG
ATTCGGAGGATTCGGTGGCCAACAGCAGCAGCAAGAAGGATTCGGCGGTT
TCGGAGGCTTCGGAGAACAGCAACAGCAGCAGGAAAGCTTCGGTGGATTC
GGCGGATTTGGAGGAATCGAGCAGCAGCAGCAGCAGCAACAAGGAGGCTT
CTTCTAAAAGCTTTCTAGACC

BS16112.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:41:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG15282-PA 240 CG15282-RA 1..240 18..257 1200 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 01:42:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG15282-RB 383 CG15282-RB 78..317 18..257 1200 100 Plus
CG15282-RC 521 CG15282-RC 216..455 18..257 1200 100 Plus
CG15282-RA 563 CG15282-RA 78..317 18..257 1200 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 01:42:10
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 14712824..14713052 29..257 1145 100 Plus
Blast to na_te.dros performed on 2015-02-13 01:42:14 has no hits.

BS16112.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:02:14 Download gff for BS16112.5prime
Subject Subject Range Query Range Percent Splice Strand
CG15282-PA 1..240 18..257 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 00:13:45 Download gff for BS16112.5prime
Subject Subject Range Query Range Percent Splice Strand
CG15282-RA 72..325 12..267 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 03:29:57 Download gff for BS16112.5prime
Subject Subject Range Query Range Percent Splice Strand
CG15282-RA 72..325 12..267 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 03:29:57 Download gff for BS16112.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 14712819..14713060 23..267 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 00:13:45 Download gff for BS16112.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 14712819..14713060 23..267 97   Plus

BS16112.complete Sequence

272 bp assembled on 2007-05-07

GenBank Submission: FJ638063

> BS16112.complete
GAAGTTATCAGTCGACATGAAATTCTTGGTGATCGTTTTTGTGGCCCTTA
TCGCCGTTGCTTCCGCGCTTCCTCAATTCGGATATGGAGGATTCGGTGGA
TTCGGAGGATTCGGTGGCCAACAGCAGCAGCAAGAAGGATTCGGCGGTTT
CGGAGGCTTCGGAGAACAGCAACAGCAGCAGGAAAGCTTCGGTGGATTCG
GCGGATTTGGAGGAATCGAGCAGCAGCAGCAGCAGCAACAAGGAGGCTTC
TTCTAAAAGCTTTCTAGACCAT

BS16112.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:01:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG15282-RB 240 CG15282-PB 1..240 17..256 1200 100 Plus
CG15282-RC 240 CG15282-PC 1..240 17..256 1200 100 Plus
CG15282-RA 240 CG15282-PA 1..240 17..256 1200 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:01:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG15282-RB 383 CG15282-RB 78..317 17..256 1200 100 Plus
CG15282-RC 521 CG15282-RC 216..455 17..256 1200 100 Plus
CG15282-RA 563 CG15282-RA 78..317 17..256 1200 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:01:33
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 14712824..14713052 28..256 1145 100 Plus
Blast to na_te.dros performed on 2014-11-27 13:01:34 has no hits.

BS16112.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:23:00 Download gff for BS16112.complete
Subject Subject Range Query Range Percent Splice Strand
CG15282-RA 1..240 17..256 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:30:40 Download gff for BS16112.complete
Subject Subject Range Query Range Percent Splice Strand
CG15282-RA 73..325 12..266 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:44:13 Download gff for BS16112.complete
Subject Subject Range Query Range Percent Splice Strand
CG15282-RA 78..315 17..254 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:23:00 Download gff for BS16112.complete
Subject Subject Range Query Range Percent Splice Strand
CG15282-RA 73..325 12..266 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:09:31 Download gff for BS16112.complete
Subject Subject Range Query Range Percent Splice Strand
CG15282-RA 78..315 17..254 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:09:31 Download gff for BS16112.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14712819..14713050 22..254 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:44:13 Download gff for BS16112.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 14712819..14713050 22..254 99   Plus

BS16112.pep Sequence

Translation from 16 to 255

> BS16112.pep
MKFLVIVFVALIAVASALPQFGYGGFGGFGGFGGQQQQQEGFGGFGGFGE
QQQQQESFGGFGGFGGIEQQQQQQQGGFF*

BS16112.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:41:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG15282-PB 79 CG15282-PB 1..79 1..79 420 100 Plus
CG15282-PC 79 CG15282-PC 1..79 1..79 420 100 Plus
CG15282-PA 79 CG15282-PA 1..79 1..79 420 100 Plus
CG4440-PB 79 CG4440-PB 1..74 1..78 228 66.7 Plus
CG4440-PA 79 CG4440-PA 1..74 1..78 228 66.7 Plus