Clone Sequence Records
BS16112.3prime Sequence
270 bp (270 high quality bases) assembled on 2007-04-16
> BS16112.3prime
ATGGTCTAGAAAGCTTTTACAAGAAGCCTCCTTGTTGCTGCTGCTGCTGC
TGCTCGATTCCTCCAAATCCGCCGAATCCACCGAAGCTTTCCTGCTGCTG
TTGCTGTTCTCCGAAGCCTCCGAAACCGCCGAATCCTTCTTGCTGCTGCT
GTTGGCCACCGAATCCTCCGAATCCACCGAATCCTCCATATCCGAATTGA
GGAAGCGCGGAAGCAACGGCGATAAGGGCCACAAAAACGATCACCAAGAA
TTTCATGTCGACTGATAACT
BS16112.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:41:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15282-PA | 240 | CG15282-RA | 1..236 | 256..21 | 1180 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 19:10:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15282-RB | 383 | CG15282-RB | 78..317 | 256..17 | 1185 | 99.6 | Minus |
CG15282-RC | 521 | CG15282-RC | 216..455 | 256..17 | 1185 | 99.6 | Minus |
CG15282-RA | 563 | CG15282-RA | 78..317 | 256..17 | 1185 | 99.6 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 19:10:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 14712824..14713052 | 245..17 | 1130 | 99.6 | Minus |
Blast to na_te.dros performed on 2015-02-11 19:10:36 has no hits.
BS16112.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:02:14 Download gff for
BS16112.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15282-PA | 1..240 | 17..256 | 99 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-27 05:12:06 Download gff for
BS16112.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15282-RA | 73..325 | 7..261 | 97 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 00:07:49 Download gff for
BS16112.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15282-RA | 73..325 | 7..261 | 97 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 00:07:49 Download gff for
BS16112.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 14712819..14713060 | 7..251 | 97 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-27 05:12:06 Download gff for
BS16112.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 14712819..14713060 | 7..251 | 97 | | Minus |
BS16112.5prime Sequence
271 bp (271 high quality bases) assembled on 2007-04-16
> BS16112.5prime
GAAGTGTATCCTTCGACATGAAATTCTTGGTGATCGTTTTTGTGGCCCTT
ATCGCCGTTGCTTCCGCGCTTCCTCAATTCGGATATGGAGGATTCGGTGG
ATTCGGAGGATTCGGTGGCCAACAGCAGCAGCAAGAAGGATTCGGCGGTT
TCGGAGGCTTCGGAGAACAGCAACAGCAGCAGGAAAGCTTCGGTGGATTC
GGCGGATTTGGAGGAATCGAGCAGCAGCAGCAGCAGCAACAAGGAGGCTT
CTTCTAAAAGCTTTCTAGACC
BS16112.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:41:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15282-PA | 240 | CG15282-RA | 1..240 | 18..257 | 1200 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 01:42:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15282-RB | 383 | CG15282-RB | 78..317 | 18..257 | 1200 | 100 | Plus |
CG15282-RC | 521 | CG15282-RC | 216..455 | 18..257 | 1200 | 100 | Plus |
CG15282-RA | 563 | CG15282-RA | 78..317 | 18..257 | 1200 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 01:42:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 14712824..14713052 | 29..257 | 1145 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-13 01:42:14 has no hits.
BS16112.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:02:14 Download gff for
BS16112.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15282-PA | 1..240 | 18..257 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 00:13:45 Download gff for
BS16112.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15282-RA | 72..325 | 12..267 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 03:29:57 Download gff for
BS16112.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15282-RA | 72..325 | 12..267 | 97 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 03:29:57 Download gff for
BS16112.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 14712819..14713060 | 23..267 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 00:13:45 Download gff for
BS16112.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 14712819..14713060 | 23..267 | 97 | | Plus |
BS16112.complete Sequence
272 bp assembled on 2007-05-07
GenBank Submission: FJ638063
> BS16112.complete
GAAGTTATCAGTCGACATGAAATTCTTGGTGATCGTTTTTGTGGCCCTTA
TCGCCGTTGCTTCCGCGCTTCCTCAATTCGGATATGGAGGATTCGGTGGA
TTCGGAGGATTCGGTGGCCAACAGCAGCAGCAAGAAGGATTCGGCGGTTT
CGGAGGCTTCGGAGAACAGCAACAGCAGCAGGAAAGCTTCGGTGGATTCG
GCGGATTTGGAGGAATCGAGCAGCAGCAGCAGCAGCAACAAGGAGGCTTC
TTCTAAAAGCTTTCTAGACCAT
BS16112.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:01:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15282-RB | 240 | CG15282-PB | 1..240 | 17..256 | 1200 | 100 | Plus |
CG15282-RC | 240 | CG15282-PC | 1..240 | 17..256 | 1200 | 100 | Plus |
CG15282-RA | 240 | CG15282-PA | 1..240 | 17..256 | 1200 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:01:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15282-RB | 383 | CG15282-RB | 78..317 | 17..256 | 1200 | 100 | Plus |
CG15282-RC | 521 | CG15282-RC | 216..455 | 17..256 | 1200 | 100 | Plus |
CG15282-RA | 563 | CG15282-RA | 78..317 | 17..256 | 1200 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:01:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 14712824..14713052 | 28..256 | 1145 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 13:01:34 has no hits.
BS16112.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:23:00 Download gff for
BS16112.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15282-RA | 1..240 | 17..256 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:30:40 Download gff for
BS16112.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15282-RA | 73..325 | 12..266 | 97 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:44:13 Download gff for
BS16112.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15282-RA | 78..315 | 17..254 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:23:00 Download gff for
BS16112.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15282-RA | 73..325 | 12..266 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:09:31 Download gff for
BS16112.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15282-RA | 78..315 | 17..254 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:09:31 Download gff for
BS16112.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 14712819..14713050 | 22..254 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:44:13 Download gff for
BS16112.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 14712819..14713050 | 22..254 | 99 | | Plus |
BS16112.pep Sequence
Translation from 16 to 255
> BS16112.pep
MKFLVIVFVALIAVASALPQFGYGGFGGFGGFGGQQQQQEGFGGFGGFGE
QQQQQESFGGFGGFGGIEQQQQQQQGGFF*
BS16112.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:41:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15282-PB | 79 | CG15282-PB | 1..79 | 1..79 | 420 | 100 | Plus |
CG15282-PC | 79 | CG15282-PC | 1..79 | 1..79 | 420 | 100 | Plus |
CG15282-PA | 79 | CG15282-PA | 1..79 | 1..79 | 420 | 100 | Plus |
CG4440-PB | 79 | CG4440-PB | 1..74 | 1..78 | 228 | 66.7 | Plus |
CG4440-PA | 79 | CG4440-PA | 1..74 | 1..78 | 228 | 66.7 | Plus |