Clone BS16120 Report

Search the DGRC for BS16120

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:161
Well:20
Vector:pDNR-Dual
Associated Gene/TranscriptmRpS21-RA
Protein status:BS16120.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS16120.3prime Sequence

294 bp (294 high quality bases) assembled on 2007-04-16

> BS16120.3prime
ATGGTCTAGAAAGCTTTTAACTGCATCCAGGAAAAGGTTCGGCGCGATTT
TTGCGCAGTACGAACTGAATTTTTCGGTTCATGTCCTCGTTGTAAATGGC
CTTGCATTTCTCGAAGTTGATGCGACGACGAACCTGATACGGCTTTTCGT
AGAATCGCGTGCGGCGAAATTGGTCGAGCAGTTCTTCTTTTCCCAAGACG
CGATTTAACAGACGACACGCCTCCTCCACATTATTGTTTTGCACCAGAAC
GGTGCGGGCCAGAAACTGCACGTGTCTCATGTCGACTGATAACT

BS16120.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:42:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG32854-PA 264 mRpS21-RA 1..264 280..17 1320 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:14:29
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS21-RB 475 CG32854-RB 97..365 284..16 1330 99.6 Minus
mRpS21-RA 422 CG32854-RA 97..365 284..16 1330 99.6 Minus
CG8870-RA 1535 CG8870-RA 1412..1531 16..135 600 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:14:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13381558..13381713 129..284 765 99.4 Plus
3R 32079331 3R 13381386..13381505 16..135 600 100 Plus
Blast to na_te.dros performed on 2015-02-12 10:14:28 has no hits.

BS16120.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:02:16 Download gff for BS16120.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32854-PA 1..264 17..280 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 21:44:30 Download gff for BS16120.3prime
Subject Subject Range Query Range Percent Splice Strand
mRpS21-RA 90..367 12..294 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 12:56:50 Download gff for BS16120.3prime
Subject Subject Range Query Range Percent Splice Strand
mRpS21-RA 90..367 12..294 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 12:56:50 Download gff for BS16120.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 13381384..13381503 12..133 98 <- Plus
3R 13381563..13381720 134..294 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 21:44:30 Download gff for BS16120.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9207106..9207225 12..133 98 <- Plus
arm_3R 9207285..9207442 134..294 96   Plus

BS16120.5prime Sequence

294 bp (294 high quality bases) assembled on 2007-04-16

> BS16120.5prime
GAAGTTATCAGTCGACATGAGACACGTGCAGTTTCTGGCCCGCACCGTTC
TGGTGCAAAACAATAATGTGGAGGAGGCGTGTCGTCTGTTAAATCGCGTC
TTGGGAAAAGAAGAACTGCTCGACCAATTTCGCCGCACGCGATTCTACGA
AAAGCCGTATCAGGTTCGTCGTCGCATCAACTTCGAGAAATGCAAGGCCA
TTTACAACGAGGACATGAACCGAAAAATTCAGTTCGTACTGCGCAAAAAT
CGCGCCGAACCTTTTCCTGGATGCAGTTAAAAGCTTTCTAGACC

BS16120.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:42:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG32854-PA 264 mRpS21-RA 1..264 17..280 1320 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 01:42:32
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS21-RB 475 CG32854-RB 97..365 13..281 1330 99.6 Plus
mRpS21-RA 422 CG32854-RA 97..365 13..281 1330 99.6 Plus
CG8870-RA 1535 CG8870-RA 1412..1531 281..162 600 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 01:42:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13381558..13381713 168..13 765 99.4 Minus
3R 32079331 3R 13381386..13381505 281..162 600 100 Minus
Blast to na_te.dros performed on 2015-02-13 01:42:27 has no hits.

BS16120.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:02:16 Download gff for BS16120.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32854-PA 1..264 17..280 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 00:13:47 Download gff for BS16120.5prime
Subject Subject Range Query Range Percent Splice Strand
mRpS21-RA 92..367 5..285 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 03:31:08 Download gff for BS16120.5prime
Subject Subject Range Query Range Percent Splice Strand
mRpS21-RA 92..367 5..285 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 03:31:08 Download gff for BS16120.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 13381384..13381503 164..285 98 <- Minus
3R 13381563..13381718 5..163 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 00:13:47 Download gff for BS16120.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9207106..9207225 164..285 98 <- Minus
arm_3R 9207285..9207440 5..163 97   Minus

BS16120.complete Sequence

296 bp assembled on 2007-05-07

GenBank Submission: FJ638065

> BS16120.complete
GAAGTTATCAGTCGACATGAGACACGTGCAGTTTCTGGCCCGCACCGTTC
TGGTGCAAAACAATAATGTGGAGGAGGCGTGTCGTCTGTTAAATCGCGTC
TTGGGAAAAGAAGAACTGCTCGACCAATTTCGCCGCACGCGATTCTACGA
AAAGCCGTATCAGGTTCGTCGTCGCATCAACTTCGAGAAATGCAAGGCCA
TTTACAACGAGGACATGAACCGAAAAATTCAGTTCGTACTGCGCAAAAAT
CGCGCCGAACCTTTTCCTGGATGCAGTTAAAAGCTTTCTAGACCAT

BS16120.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:46:25
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS21-RB 264 CG32854-PB 1..264 17..280 1320 100 Plus
mRpS21-RA 264 CG32854-PA 1..264 17..280 1320 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:46:26
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS21-RB 475 CG32854-RB 97..365 13..281 1330 99.6 Plus
mRpS21-RA 422 CG32854-RA 97..365 13..281 1330 99.6 Plus
CG8870-RA 1535 CG8870-RA 1412..1531 281..162 600 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:46:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13381558..13381713 168..13 765 99.4 Minus
3R 32079331 3R 13381386..13381505 281..162 600 100 Minus
Blast to na_te.dros performed on 2014-11-26 21:46:24 has no hits.

BS16120.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:20:03 Download gff for BS16120.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS21-RA 1..264 17..280 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:01:10 Download gff for BS16120.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS21-RA 75..350 5..285 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:36:14 Download gff for BS16120.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS21-RA 101..362 17..278 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:20:04 Download gff for BS16120.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS21-RA 75..350 5..285 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:41:53 Download gff for BS16120.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS21-RA 101..362 17..278 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:41:53 Download gff for BS16120.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13381389..13381503 164..278 100 <- Minus
3R 13381563..13381709 17..163 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:36:14 Download gff for BS16120.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9207111..9207225 164..278 100 <- Minus
arm_3R 9207285..9207431 17..163 100   Minus

BS16120.pep Sequence

Translation from 16 to 279

> BS16120.pep
MRHVQFLARTVLVQNNNVEEACRLLNRVLGKEELLDQFRRTRFYEKPYQV
RRRINFEKCKAIYNEDMNRKIQFVLRKNRAEPFPGCS*

BS16120.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:52:06
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS21-PB 87 CG32854-PB 1..87 1..87 457 100 Plus
mRpS21-PA 87 CG32854-PA 1..87 1..87 457 100 Plus