Clone Sequence Records
BS16120.3prime Sequence
294 bp (294 high quality bases) assembled on 2007-04-16
> BS16120.3prime
ATGGTCTAGAAAGCTTTTAACTGCATCCAGGAAAAGGTTCGGCGCGATTT
TTGCGCAGTACGAACTGAATTTTTCGGTTCATGTCCTCGTTGTAAATGGC
CTTGCATTTCTCGAAGTTGATGCGACGACGAACCTGATACGGCTTTTCGT
AGAATCGCGTGCGGCGAAATTGGTCGAGCAGTTCTTCTTTTCCCAAGACG
CGATTTAACAGACGACACGCCTCCTCCACATTATTGTTTTGCACCAGAAC
GGTGCGGGCCAGAAACTGCACGTGTCTCATGTCGACTGATAACT
BS16120.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:42:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32854-PA | 264 | mRpS21-RA | 1..264 | 280..17 | 1320 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:14:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
mRpS21-RB | 475 | CG32854-RB | 97..365 | 284..16 | 1330 | 99.6 | Minus |
mRpS21-RA | 422 | CG32854-RA | 97..365 | 284..16 | 1330 | 99.6 | Minus |
CG8870-RA | 1535 | CG8870-RA | 1412..1531 | 16..135 | 600 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:14:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 13381558..13381713 | 129..284 | 765 | 99.4 | Plus |
3R | 32079331 | 3R | 13381386..13381505 | 16..135 | 600 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-12 10:14:28 has no hits.
BS16120.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:02:16 Download gff for
BS16120.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32854-PA | 1..264 | 17..280 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 21:44:30 Download gff for
BS16120.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
mRpS21-RA | 90..367 | 12..294 | 97 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 12:56:50 Download gff for
BS16120.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
mRpS21-RA | 90..367 | 12..294 | 97 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 12:56:50 Download gff for
BS16120.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 13381384..13381503 | 12..133 | 98 | <- | Plus |
3R | 13381563..13381720 | 134..294 | 96 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 21:44:30 Download gff for
BS16120.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 9207106..9207225 | 12..133 | 98 | <- | Plus |
arm_3R | 9207285..9207442 | 134..294 | 96 | | Plus |
BS16120.5prime Sequence
294 bp (294 high quality bases) assembled on 2007-04-16
> BS16120.5prime
GAAGTTATCAGTCGACATGAGACACGTGCAGTTTCTGGCCCGCACCGTTC
TGGTGCAAAACAATAATGTGGAGGAGGCGTGTCGTCTGTTAAATCGCGTC
TTGGGAAAAGAAGAACTGCTCGACCAATTTCGCCGCACGCGATTCTACGA
AAAGCCGTATCAGGTTCGTCGTCGCATCAACTTCGAGAAATGCAAGGCCA
TTTACAACGAGGACATGAACCGAAAAATTCAGTTCGTACTGCGCAAAAAT
CGCGCCGAACCTTTTCCTGGATGCAGTTAAAAGCTTTCTAGACC
BS16120.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:42:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32854-PA | 264 | mRpS21-RA | 1..264 | 17..280 | 1320 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 01:42:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
mRpS21-RB | 475 | CG32854-RB | 97..365 | 13..281 | 1330 | 99.6 | Plus |
mRpS21-RA | 422 | CG32854-RA | 97..365 | 13..281 | 1330 | 99.6 | Plus |
CG8870-RA | 1535 | CG8870-RA | 1412..1531 | 281..162 | 600 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 01:42:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 13381558..13381713 | 168..13 | 765 | 99.4 | Minus |
3R | 32079331 | 3R | 13381386..13381505 | 281..162 | 600 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-13 01:42:27 has no hits.
BS16120.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:02:16 Download gff for
BS16120.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32854-PA | 1..264 | 17..280 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 00:13:47 Download gff for
BS16120.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
mRpS21-RA | 92..367 | 5..285 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 03:31:08 Download gff for
BS16120.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
mRpS21-RA | 92..367 | 5..285 | 97 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 03:31:08 Download gff for
BS16120.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 13381384..13381503 | 164..285 | 98 | <- | Minus |
3R | 13381563..13381718 | 5..163 | 97 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 00:13:47 Download gff for
BS16120.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 9207106..9207225 | 164..285 | 98 | <- | Minus |
arm_3R | 9207285..9207440 | 5..163 | 97 | | Minus |
BS16120.complete Sequence
296 bp assembled on 2007-05-07
GenBank Submission: FJ638065
> BS16120.complete
GAAGTTATCAGTCGACATGAGACACGTGCAGTTTCTGGCCCGCACCGTTC
TGGTGCAAAACAATAATGTGGAGGAGGCGTGTCGTCTGTTAAATCGCGTC
TTGGGAAAAGAAGAACTGCTCGACCAATTTCGCCGCACGCGATTCTACGA
AAAGCCGTATCAGGTTCGTCGTCGCATCAACTTCGAGAAATGCAAGGCCA
TTTACAACGAGGACATGAACCGAAAAATTCAGTTCGTACTGCGCAAAAAT
CGCGCCGAACCTTTTCCTGGATGCAGTTAAAAGCTTTCTAGACCAT
BS16120.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:46:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
mRpS21-RB | 264 | CG32854-PB | 1..264 | 17..280 | 1320 | 100 | Plus |
mRpS21-RA | 264 | CG32854-PA | 1..264 | 17..280 | 1320 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:46:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
mRpS21-RB | 475 | CG32854-RB | 97..365 | 13..281 | 1330 | 99.6 | Plus |
mRpS21-RA | 422 | CG32854-RA | 97..365 | 13..281 | 1330 | 99.6 | Plus |
CG8870-RA | 1535 | CG8870-RA | 1412..1531 | 281..162 | 600 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:46:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 13381558..13381713 | 168..13 | 765 | 99.4 | Minus |
3R | 32079331 | 3R | 13381386..13381505 | 281..162 | 600 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 21:46:24 has no hits.
BS16120.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:20:03 Download gff for
BS16120.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
mRpS21-RA | 1..264 | 17..280 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:01:10 Download gff for
BS16120.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
mRpS21-RA | 75..350 | 5..285 | 97 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:36:14 Download gff for
BS16120.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
mRpS21-RA | 101..362 | 17..278 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:20:04 Download gff for
BS16120.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
mRpS21-RA | 75..350 | 5..285 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:41:53 Download gff for
BS16120.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
mRpS21-RA | 101..362 | 17..278 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:41:53 Download gff for
BS16120.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 13381389..13381503 | 164..278 | 100 | <- | Minus |
3R | 13381563..13381709 | 17..163 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:36:14 Download gff for
BS16120.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 9207111..9207225 | 164..278 | 100 | <- | Minus |
arm_3R | 9207285..9207431 | 17..163 | 100 | | Minus |
BS16120.pep Sequence
Translation from 16 to 279
> BS16120.pep
MRHVQFLARTVLVQNNNVEEACRLLNRVLGKEELLDQFRRTRFYEKPYQV
RRRINFEKCKAIYNEDMNRKIQFVLRKNRAEPFPGCS*
BS16120.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:52:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
mRpS21-PB | 87 | CG32854-PB | 1..87 | 1..87 | 457 | 100 | Plus |
mRpS21-PA | 87 | CG32854-PA | 1..87 | 1..87 | 457 | 100 | Plus |