Clone BS16130 Report

Search the DGRC for BS16130

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:161
Well:30
Vector:pDNR-Dual
Associated Gene/TranscriptCG12859-RA
Protein status:BS16130.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS16130.3prime Sequence

372 bp (372 high quality bases) assembled on 2007-04-16

> BS16130.3prime
ATGGTCTAGAAAGCTTTTACATGAACTTGAACTGGCGGTCCTTGTAGGCC
ACCTGGCCAGTCCTGTACTTCTCCTCGCGTCCATCGCGCTCCGCCTTCAA
AGCCCAGGCGTAGAGGGCAATCGGCAGGACGACGGCGAAAAGGCCCGTGC
GGAAGGATTTGCCGGTGGGCTTGAAGTGTTCGTAGTTGGAGACTCGCATC
GCCTGGAAACGGGCTAATCCCGCATCGAAAACGGTGCCGCCCTCGCCGGT
GGCATGGCGGTAGGGATTGGAGCTCTGCTTGAGGAACTCCTGGCGCAGCT
TCAGCGTCGCCTCGTGCTTGCGCTTAATGAACTCCTGCTCCTCGTTGGAC
AAAACCATGTCGACTGATAACT

BS16130.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:44:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG12859-PA 342 CG12859-RA 1..338 358..21 1690 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:15:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG12859-RA 477 CG12859-RA 70..411 358..17 1695 99.7 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 16:15:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14756794..14757006 229..17 1050 99.5 Minus
2R 25286936 2R 14756585..14756713 358..230 645 100 Minus
Blast to na_te.dros performed on 2015-02-13 16:15:26 has no hits.

BS16130.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:02:20 Download gff for BS16130.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12859-PA 1..342 17..358 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 12:57:59 Download gff for BS16130.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12859-RA 64..413 13..365 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 18:24:55 Download gff for BS16130.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12859-RA 64..413 13..365 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 18:24:55 Download gff for BS16130.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 14756579..14756713 230..365 97 -> Minus
2R 14756794..14757008 13..229 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 12:57:59 Download gff for BS16130.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10644084..10644218 230..365 97 -> Minus
arm_2R 10644299..10644513 13..229 98   Minus

BS16130.5prime Sequence

372 bp (372 high quality bases) assembled on 2007-04-16

> BS16130.5prime
GAAGTTATCAGTCGACATGGTTTTGTCCAACGAGGAGCAGGAGTTCATTA
AGCGCAAGCACGAGGCGACGCTGAAGCTGCGCCAGGAGTTCCTCAAGCAG
AGCTCCAATCCCTACCGCCATGCCACCGGCGAGGGCGGCACCGTTTTCGA
TGCGGGATTAGCCCGTTTCCAGGCGATGCGAGTCTCCAACTACGAACACT
TCAAGCCCACCGGCAAATCCTTCCGCACGGGCCTTTTCGCCGTCGTCCTG
CCGATTGCCCTCTACGCCTGGGCTTTGAAGGCGGAGCGCGATGGACGCGA
GGAGAAGTACAGGACTGGCCAGGTGGCCTACAAGGACCGCCAGTTCAAGT
TCATCTAAAAGCTTTCTAGACC

BS16130.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:44:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG12859-PA 342 CG12859-RA 1..342 17..358 1710 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 23:11:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG12859-RA 477 CG12859-RA 70..411 17..358 1710 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 23:10:56
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14756794..14757006 146..358 1065 100 Plus
2R 25286936 2R 14756585..14756713 17..145 645 100 Plus
Blast to na_te.dros performed on 2015-02-11 23:10:59 has no hits.

BS16130.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:02:21 Download gff for BS16130.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12859-PA 1..342 17..358 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 04:44:52 Download gff for BS16130.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12859-RA 64..413 10..362 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:38:38 Download gff for BS16130.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12859-RA 64..413 10..362 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 01:38:38 Download gff for BS16130.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 14756579..14756713 10..145 97 -> Plus
2R 14756794..14757008 146..362 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 04:44:52 Download gff for BS16130.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10644084..10644218 10..145 97 -> Plus
arm_2R 10644299..10644513 146..362 99   Plus

BS16130.complete Sequence

374 bp assembled on 2007-05-07

GenBank Submission: FJ638068

> BS16130.complete
GAAGTTATCAGTCGACATGGTTTTGTCCAACGAGGAGCAGGAGTTCATTA
AGCGCAAGCACGAGGCGACGCTGAAGCTGCGCCAGGAGTTCCTCAAGCAG
AGCTCCAATCCCTACCGCCATGCCACCGGCGAGGGCGGCACCGTTTTCGA
TGCGGGATTAGCCCGTTTCCAGGCGATGCGAGTCTCCAACTACGAACACT
TCAAGCCCACCGGCAAATCCTTCCGCACGGGCCTTTTCGCCGTCGTCCTG
CCGATTGCCCTCTACGCCTGGGCTTTGAAGGCGGAGCGCGATGGACGCGA
GGAGAAGTACAGGACTGGCCAGGTGGCCTACAAGGACCGCCAGTTCAAGT
TCATCTAAAAGCTTTCTAGACCAT

BS16130.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:34:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG12859-RA 342 CG12859-PA 1..342 17..358 1710 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:34:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG12859-RA 477 CG12859-RA 70..411 17..358 1710 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:34:15
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14756794..14757006 146..358 1065 100 Plus
2R 25286936 2R 14756585..14756713 17..145 645 100 Plus
Blast to na_te.dros performed on 2014-11-27 13:34:16 has no hits.

BS16130.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:20:07 Download gff for BS16130.complete
Subject Subject Range Query Range Percent Splice Strand
CG12859-RA 1..342 17..358 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:01:14 Download gff for BS16130.complete
Subject Subject Range Query Range Percent Splice Strand
CG12859-RA 59..408 10..362 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:02:34 Download gff for BS16130.complete
Subject Subject Range Query Range Percent Splice Strand
CG12859-RA 70..409 17..356 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:20:07 Download gff for BS16130.complete
Subject Subject Range Query Range Percent Splice Strand
CG12859-RA 59..408 10..362 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:21:28 Download gff for BS16130.complete
Subject Subject Range Query Range Percent Splice Strand
CG12859-RA 70..409 17..356 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:21:28 Download gff for BS16130.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14756794..14757004 146..356 100   Plus
2R 14756585..14756713 17..145 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:02:34 Download gff for BS16130.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10644090..10644218 17..145 100 -> Plus
arm_2R 10644299..10644509 146..356 100   Plus

BS16130.pep Sequence

Translation from 16 to 357

> BS16130.pep
MVLSNEEQEFIKRKHEATLKLRQEFLKQSSNPYRHATGEGGTVFDAGLAR
FQAMRVSNYEHFKPTGKSFRTGLFAVVLPIALYAWALKAERDGREEKYRT
GQVAYKDRQFKFI*

BS16130.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:52:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG12859-PA 113 CG12859-PA 1..113 1..113 585 100 Plus