Clone Sequence Records
BS16136.3prime Sequence
201 bp (201 high quality bases) assembled on 2007-04-16
> BS16136.3prime
ATGGTCTAGAAAGCTTTTAGTCCAGCTTCTTGAAGCCAATGTCGTTGGCG
TACTCCCTGAAGCACTGGCGGCAGATGTTAAGGCCATACTTGCGGATCAG
ACCGTGGCGGTTAGAGCAGGCACGGCAGCATCGGGAGCCTTGGCCATATT
TGCGGGGATGCGAGTACCAGAGAGTAGCGAAACCCATGTCGACTGATAAC
T
BS16136.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:45:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG8495-PA | 171 | RpS29-RA | 1..171 | 187..17 | 855 | 100 | Minus |
CG8495-PC | 168 | RpS29-RC | 59..168 | 126..17 | 550 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 05:07:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpS29-RB | 1007 | CG8495-RB | 92..265 | 189..16 | 870 | 100 | Minus |
RpS29-RA | 502 | CG8495-RA | 37..210 | 189..16 | 870 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 05:07:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 9778618..9778718 | 126..26 | 505 | 100 | Minus |
3R | 32079331 | 3R | 9778133..9778196 | 189..126 | 320 | 100 | Minus |
Blast to na_te.dros performed 2015-02-12 05:07:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
mdg1 | 7480 | mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). | 4877..4912 | 48..13 | 99 | 75 | Minus |
BS16136.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:02:23 Download gff for
BS16136.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8495-PA | 1..171 | 17..187 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 07:20:22 Download gff for
BS16136.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS29-RA | 37..216 | 9..189 | 98 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:32:21 Download gff for
BS16136.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS29-RA | 37..216 | 9..189 | 98 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:32:21 Download gff for
BS16136.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 9778133..9778196 | 126..189 | 100 | -> | Minus |
3R | 9778619..9778721 | 23..125 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 07:20:22 Download gff for
BS16136.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 5603855..5603918 | 126..189 | 100 | -> | Minus |
arm_3R | 5604341..5604443 | 23..125 | 99 | | Minus |
BS16136.5prime Sequence
201 bp (201 high quality bases) assembled on 2007-04-16
> BS16136.5prime
GAAGTTATCAGTCGACATGGGTTTCGCTACTCTCTGGTACTCGCATCCCC
GCAAATATGGCCAAGGCTCCCGATGCTGCCGTGCCTGCTCTAACCGCCAC
GGTCTGATCCGCAAGTATGGCCTTAACATCTGCCGCCAGTGCTTCAGGGA
GTACGCCAACGACATTGGCTTCAAGAAGCTGGACTAAAAGCTTTCTAGAC
C
BS16136.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:45:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG8495-PA | 171 | RpS29-RA | 1..171 | 17..187 | 855 | 100 | Plus |
CG8495-PC | 168 | RpS29-RC | 59..168 | 78..187 | 550 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 01:42:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpS29-RB | 1007 | CG8495-RB | 92..265 | 15..188 | 870 | 100 | Plus |
RpS29-RA | 502 | CG8495-RA | 37..210 | 15..188 | 870 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 01:42:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 9778618..9778718 | 78..178 | 505 | 100 | Plus |
3R | 32079331 | 3R | 9778133..9778196 | 15..78 | 320 | 100 | Plus |
Blast to na_te.dros performed 2015-02-13 01:42:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
mdg1 | 7480 | mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). | 4877..4912 | 156..191 | 99 | 75 | Plus |
BS16136.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:02:23 Download gff for
BS16136.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8495-PA | 1..171 | 17..187 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 00:13:51 Download gff for
BS16136.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS29-RA | 37..216 | 15..195 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 03:32:26 Download gff for
BS16136.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS29-RA | 37..216 | 15..195 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 03:32:26 Download gff for
BS16136.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 9778133..9778196 | 15..78 | 100 | -> | Plus |
3R | 9778619..9778721 | 79..181 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 00:13:51 Download gff for
BS16136.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 5603855..5603918 | 15..78 | 100 | -> | Plus |
arm_3R | 5604341..5604443 | 79..181 | 99 | | Plus |
BS16136.complete Sequence
203 bp assembled on 2007-05-07
GenBank Submission: FJ638069
> BS16136.complete
GAAGTTATCAGTCGACATGGGTTTCGCTACTCTCTGGTACTCGCATCCCC
GCAAATATGGCCAAGGCTCCCGATGCTGCCGTGCCTGCTCTAACCGCCAC
GGTCTGATCCGCAAGTATGGCCTTAACATCTGCCGCCAGTGCTTCAGGGA
GTACGCCAACGACATTGGCTTCAAGAAGCTGGACTAAAAGCTTTCTAGAC
CAT
BS16136.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:16:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpS29-RB | 171 | CG8495-PB | 1..171 | 17..187 | 855 | 100 | Plus |
RpS29-RA | 171 | CG8495-PA | 1..171 | 17..187 | 855 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:16:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpS29-RB | 1007 | CG8495-RB | 92..265 | 15..188 | 870 | 100 | Plus |
RpS29-RA | 502 | CG8495-RA | 37..210 | 15..188 | 870 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:16:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 9778618..9778718 | 78..178 | 505 | 100 | Plus |
3R | 32079331 | 3R | 9778133..9778196 | 15..78 | 320 | 100 | Plus |
Blast to na_te.dros performed 2014-11-27 08:16:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
mdg1 | 7480 | mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). | 4877..4912 | 156..191 | 99 | 75 | Plus |
BS16136.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:23:51 Download gff for
BS16136.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS29-RA | 1..171 | 17..187 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:30:44 Download gff for
BS16136.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS29-RA | 38..217 | 15..195 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:09:17 Download gff for
BS16136.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS29-RA | 39..207 | 17..185 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:23:53 Download gff for
BS16136.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS29-RA | 38..217 | 15..195 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:14:32 Download gff for
BS16136.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS29-RA | 39..207 | 17..185 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:14:32 Download gff for
BS16136.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 9778135..9778196 | 17..78 | 100 | -> | Plus |
3R | 9778619..9778724 | 79..185 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:09:17 Download gff for
BS16136.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 5603857..5603918 | 17..78 | 100 | -> | Plus |
arm_3R | 5604341..5604446 | 79..185 | 97 | | Plus |
BS16136.pep Sequence
Translation from 16 to 186
> BS16136.pep
MGFATLWYSHPRKYGQGSRCCRACSNRHGLIRKYGLNICRQCFREYANDI
GFKKLD*
BS16136.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:40:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpS29-PB | 56 | CG8495-PB | 1..56 | 1..56 | 323 | 100 | Plus |
RpS29-PA | 56 | CG8495-PA | 1..56 | 1..56 | 323 | 100 | Plus |