Clone BS16136 Report

Search the DGRC for BS16136

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:161
Well:36
Vector:pDNR-Dual
Associated Gene/TranscriptRpS29-RA
Protein status:BS16136.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS16136.3prime Sequence

201 bp (201 high quality bases) assembled on 2007-04-16

> BS16136.3prime
ATGGTCTAGAAAGCTTTTAGTCCAGCTTCTTGAAGCCAATGTCGTTGGCG
TACTCCCTGAAGCACTGGCGGCAGATGTTAAGGCCATACTTGCGGATCAG
ACCGTGGCGGTTAGAGCAGGCACGGCAGCATCGGGAGCCTTGGCCATATT
TGCGGGGATGCGAGTACCAGAGAGTAGCGAAACCCATGTCGACTGATAAC
T

BS16136.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:45:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG8495-PA 171 RpS29-RA 1..171 187..17 855 100 Minus
CG8495-PC 168 RpS29-RC 59..168 126..17 550 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 05:07:27
Subject Length Description Subject Range Query Range Score Percent Strand
RpS29-RB 1007 CG8495-RB 92..265 189..16 870 100 Minus
RpS29-RA 502 CG8495-RA 37..210 189..16 870 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 05:07:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9778618..9778718 126..26 505 100 Minus
3R 32079331 3R 9778133..9778196 189..126 320 100 Minus
Blast to na_te.dros performed 2015-02-12 05:07:24
Subject Length Description Subject Range Query Range Score Percent Strand
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 4877..4912 48..13 99 75 Minus

BS16136.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:02:23 Download gff for BS16136.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8495-PA 1..171 17..187 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 07:20:22 Download gff for BS16136.3prime
Subject Subject Range Query Range Percent Splice Strand
RpS29-RA 37..216 9..189 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:32:21 Download gff for BS16136.3prime
Subject Subject Range Query Range Percent Splice Strand
RpS29-RA 37..216 9..189 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:32:21 Download gff for BS16136.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 9778133..9778196 126..189 100 -> Minus
3R 9778619..9778721 23..125 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 07:20:22 Download gff for BS16136.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5603855..5603918 126..189 100 -> Minus
arm_3R 5604341..5604443 23..125 99   Minus

BS16136.5prime Sequence

201 bp (201 high quality bases) assembled on 2007-04-16

> BS16136.5prime
GAAGTTATCAGTCGACATGGGTTTCGCTACTCTCTGGTACTCGCATCCCC
GCAAATATGGCCAAGGCTCCCGATGCTGCCGTGCCTGCTCTAACCGCCAC
GGTCTGATCCGCAAGTATGGCCTTAACATCTGCCGCCAGTGCTTCAGGGA
GTACGCCAACGACATTGGCTTCAAGAAGCTGGACTAAAAGCTTTCTAGAC
C

BS16136.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:45:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG8495-PA 171 RpS29-RA 1..171 17..187 855 100 Plus
CG8495-PC 168 RpS29-RC 59..168 78..187 550 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 01:42:58
Subject Length Description Subject Range Query Range Score Percent Strand
RpS29-RB 1007 CG8495-RB 92..265 15..188 870 100 Plus
RpS29-RA 502 CG8495-RA 37..210 15..188 870 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 01:42:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9778618..9778718 78..178 505 100 Plus
3R 32079331 3R 9778133..9778196 15..78 320 100 Plus
Blast to na_te.dros performed 2015-02-13 01:42:54
Subject Length Description Subject Range Query Range Score Percent Strand
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 4877..4912 156..191 99 75 Plus

BS16136.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:02:23 Download gff for BS16136.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8495-PA 1..171 17..187 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 00:13:51 Download gff for BS16136.5prime
Subject Subject Range Query Range Percent Splice Strand
RpS29-RA 37..216 15..195 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 03:32:26 Download gff for BS16136.5prime
Subject Subject Range Query Range Percent Splice Strand
RpS29-RA 37..216 15..195 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 03:32:26 Download gff for BS16136.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 9778133..9778196 15..78 100 -> Plus
3R 9778619..9778721 79..181 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 00:13:51 Download gff for BS16136.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5603855..5603918 15..78 100 -> Plus
arm_3R 5604341..5604443 79..181 99   Plus

BS16136.complete Sequence

203 bp assembled on 2007-05-07

GenBank Submission: FJ638069

> BS16136.complete
GAAGTTATCAGTCGACATGGGTTTCGCTACTCTCTGGTACTCGCATCCCC
GCAAATATGGCCAAGGCTCCCGATGCTGCCGTGCCTGCTCTAACCGCCAC
GGTCTGATCCGCAAGTATGGCCTTAACATCTGCCGCCAGTGCTTCAGGGA
GTACGCCAACGACATTGGCTTCAAGAAGCTGGACTAAAAGCTTTCTAGAC
CAT

BS16136.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:16:21
Subject Length Description Subject Range Query Range Score Percent Strand
RpS29-RB 171 CG8495-PB 1..171 17..187 855 100 Plus
RpS29-RA 171 CG8495-PA 1..171 17..187 855 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:16:22
Subject Length Description Subject Range Query Range Score Percent Strand
RpS29-RB 1007 CG8495-RB 92..265 15..188 870 100 Plus
RpS29-RA 502 CG8495-RA 37..210 15..188 870 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:16:19
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9778618..9778718 78..178 505 100 Plus
3R 32079331 3R 9778133..9778196 15..78 320 100 Plus
Blast to na_te.dros performed 2014-11-27 08:16:20
Subject Length Description Subject Range Query Range Score Percent Strand
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 4877..4912 156..191 99 75 Plus

BS16136.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:23:51 Download gff for BS16136.complete
Subject Subject Range Query Range Percent Splice Strand
RpS29-RA 1..171 17..187 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:30:44 Download gff for BS16136.complete
Subject Subject Range Query Range Percent Splice Strand
RpS29-RA 38..217 15..195 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:09:17 Download gff for BS16136.complete
Subject Subject Range Query Range Percent Splice Strand
RpS29-RA 39..207 17..185 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:23:53 Download gff for BS16136.complete
Subject Subject Range Query Range Percent Splice Strand
RpS29-RA 38..217 15..195 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:14:32 Download gff for BS16136.complete
Subject Subject Range Query Range Percent Splice Strand
RpS29-RA 39..207 17..185 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:14:32 Download gff for BS16136.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9778135..9778196 17..78 100 -> Plus
3R 9778619..9778724 79..185 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:09:17 Download gff for BS16136.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5603857..5603918 17..78 100 -> Plus
arm_3R 5604341..5604446 79..185 97   Plus

BS16136.pep Sequence

Translation from 16 to 186

> BS16136.pep
MGFATLWYSHPRKYGQGSRCCRACSNRHGLIRKYGLNICRQCFREYANDI
GFKKLD*

BS16136.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:40:49
Subject Length Description Subject Range Query Range Score Percent Strand
RpS29-PB 56 CG8495-PB 1..56 1..56 323 100 Plus
RpS29-PA 56 CG8495-PA 1..56 1..56 323 100 Plus