Clone BS16175 Report

Search the DGRC for BS16175

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:161
Well:75
Vector:pDNR-Dual
Associated Gene/TranscriptCG32276-RA
Protein status:BS16175.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS16175.complete Sequence

227 bp assembled on 2007-05-07

GenBank Submission: FJ638080

> BS16175.complete
GAAGTTATCAGTCGACATGGCTCCACCACAGAGAATGCGCGTCGCTAACG
AGAAGGCCAGCAAATATGTGACAATGCGTGGCAATGTACCCAAATCCTCG
AAAACGAAAGAGGGTCAATATCCGGTGGGTCCCTGGCTCCTGGCGCTGTT
CATCTTTGTGGTCTGCGGCTCTGCCATTTTCCAGATTGTTCAGTCGATAC
GCGCCGCGTAAAAGCTTTCTAGACCAT

BS16175.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:59:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG32276-RB 195 CG32276-PB 1..195 17..211 975 100 Plus
CG32276-RA 195 CG32276-PA 1..195 17..211 975 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:59:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG32276-RB 739 CG32276-RB 87..281 17..211 975 100 Plus
CG32276-RA 865 CG32276-RA 213..407 17..211 975 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:59:45
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3198321..3198432 211..100 560 100 Minus
3L 28110227 3L 3198752..3198835 100..17 420 100 Minus
Blast to na_te.dros performed on 2014-11-27 08:59:46 has no hits.

BS16175.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:45:32 Download gff for BS16175.complete
Subject Subject Range Query Range Percent Splice Strand
CG32276-RB 1..195 17..211 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:12:16 Download gff for BS16175.complete
Subject Subject Range Query Range Percent Splice Strand
CG32276-RA 204..403 10..211 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:35:01 Download gff for BS16175.complete
Subject Subject Range Query Range Percent Splice Strand
CG32276-RA 213..405 17..209 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:45:32 Download gff for BS16175.complete
Subject Subject Range Query Range Percent Splice Strand
CG32276-RA 204..403 10..211 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:30:10 Download gff for BS16175.complete
Subject Subject Range Query Range Percent Splice Strand
CG32276-RA 213..405 17..209 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:30:10 Download gff for BS16175.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3198323..3198431 101..209 100 <- Minus
3L 3198752..3198835 17..100 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:35:01 Download gff for BS16175.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3198323..3198431 101..209 100 <- Minus
arm_3L 3198752..3198835 17..100 100   Minus

BS16175.3prime Sequence

225 bp (225 high quality bases) assembled on 2007-04-16

> BS16175.3prime
ATGGTCTAGAAAGCTTTTACGCGGCGCGTATCGACTGAACAATCTGGAAA
ATGGCAGAGCCGCAGACCACAAAGATGAACAGCGCCAGGAGCCAGGGACC
CACCGGATATTGACCCTCTTTCGTTTTCGAGGATTTGGGTACATTGCCAC
GCATTGTCACATATTTGCTGGCCTTCTCGTTAGCGACGCGCATTCTCTGT
GGTGGAGCCATGTCGACTGATAACT

BS16175.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:52:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG32276-PA 195 CG32276-RA 1..195 211..17 975 100 Minus
CG32276-PB 195 CG32276-RB 1..195 211..17 975 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 19:11:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG32276-RB 739 CG32276-RB 87..281 211..17 975 100 Minus
CG32276-RA 865 CG32276-RA 213..407 211..17 975 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 19:11:07
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3198321..3198432 17..128 560 100 Plus
3L 28110227 3L 3198752..3198835 128..211 420 100 Plus
Blast to na_te.dros performed on 2015-02-11 19:11:08 has no hits.

BS16175.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:02:45 Download gff for BS16175.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32276-PB 1..195 17..211 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-27 05:12:20 Download gff for BS16175.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32276-RA 208..407 17..218 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 00:08:56 Download gff for BS16175.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32276-RA 208..407 17..218 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 00:08:56 Download gff for BS16175.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 3198321..3198431 17..127 100 <- Plus
3L 3198752..3198840 128..218 95   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-27 05:12:20 Download gff for BS16175.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3198321..3198431 17..127 100 <- Plus
arm_3L 3198752..3198840 128..218 95   Plus

BS16175.5prime Sequence

225 bp (225 high quality bases) assembled on 2007-04-16

> BS16175.5prime
GAAGTTATCAGTCGACATGGCTCCACCACAGAGAATGCGCGTCGCTAACG
AGAAGGCCAGCAAATATGTGACAATGCGTGGCAATGTACCCAAATCCTCG
AAAACGAAAGAGGGTCAATATCCGGTGGGTCCCTGGCTCCTGGCGCTGTT
CATCTTTGTGGTCTGCGGCTCTGCCATTTTCCAGATTGTTCAGTCGATAC
GCGCCGCGTAAAAGCTTTCTAGACC

BS16175.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:53:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG32276-PA 195 CG32276-RA 1..195 17..211 975 100 Plus
CG32276-PB 195 CG32276-RB 1..195 17..211 975 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 04:40:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG32276-RB 739 CG32276-RB 87..281 17..211 975 100 Plus
CG32276-RA 865 CG32276-RA 213..407 17..211 975 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 04:40:38
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3198321..3198432 211..100 560 100 Minus
3L 28110227 3L 3198752..3198835 100..17 420 100 Minus
Blast to na_te.dros performed on 2015-02-11 04:40:42 has no hits.

BS16175.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:02:46 Download gff for BS16175.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32276-PB 1..195 17..211 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 09:11:53 Download gff for BS16175.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32276-RA 208..407 10..211 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:15:18 Download gff for BS16175.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32276-RA 208..407 10..211 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 09:15:18 Download gff for BS16175.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 3198321..3198431 101..211 100 <- Minus
3L 3198752..3198840 10..100 95   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 09:11:53 Download gff for BS16175.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3198321..3198431 101..211 100 <- Minus
arm_3L 3198752..3198840 10..100 95   Minus

BS16175.pep Sequence

Translation from 16 to 210

> BS16175.pep
MAPPQRMRVANEKASKYVTMRGNVPKSSKTKEGQYPVGPWLLALFIFVVC
GSAIFQIVQSIRAA*

BS16175.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:25:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG32276-PB 64 CG32276-PB 1..64 1..64 327 100 Plus
CG32276-PA 64 CG32276-PA 1..64 1..64 327 100 Plus