Clone Sequence Records
BS16175.complete Sequence
227 bp assembled on 2007-05-07
GenBank Submission: FJ638080
> BS16175.complete
GAAGTTATCAGTCGACATGGCTCCACCACAGAGAATGCGCGTCGCTAACG
AGAAGGCCAGCAAATATGTGACAATGCGTGGCAATGTACCCAAATCCTCG
AAAACGAAAGAGGGTCAATATCCGGTGGGTCCCTGGCTCCTGGCGCTGTT
CATCTTTGTGGTCTGCGGCTCTGCCATTTTCCAGATTGTTCAGTCGATAC
GCGCCGCGTAAAAGCTTTCTAGACCAT
BS16175.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:59:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32276-RB | 195 | CG32276-PB | 1..195 | 17..211 | 975 | 100 | Plus |
CG32276-RA | 195 | CG32276-PA | 1..195 | 17..211 | 975 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:59:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32276-RB | 739 | CG32276-RB | 87..281 | 17..211 | 975 | 100 | Plus |
CG32276-RA | 865 | CG32276-RA | 213..407 | 17..211 | 975 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:59:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 3198321..3198432 | 211..100 | 560 | 100 | Minus |
3L | 28110227 | 3L | 3198752..3198835 | 100..17 | 420 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-27 08:59:46 has no hits.
BS16175.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:45:32 Download gff for
BS16175.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32276-RB | 1..195 | 17..211 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:12:16 Download gff for
BS16175.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32276-RA | 204..403 | 10..211 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:35:01 Download gff for
BS16175.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32276-RA | 213..405 | 17..209 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:45:32 Download gff for
BS16175.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32276-RA | 204..403 | 10..211 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:30:10 Download gff for
BS16175.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32276-RA | 213..405 | 17..209 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:30:10 Download gff for
BS16175.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3198323..3198431 | 101..209 | 100 | <- | Minus |
3L | 3198752..3198835 | 17..100 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:35:01 Download gff for
BS16175.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 3198323..3198431 | 101..209 | 100 | <- | Minus |
arm_3L | 3198752..3198835 | 17..100 | 100 | | Minus |
BS16175.3prime Sequence
225 bp (225 high quality bases) assembled on 2007-04-16
> BS16175.3prime
ATGGTCTAGAAAGCTTTTACGCGGCGCGTATCGACTGAACAATCTGGAAA
ATGGCAGAGCCGCAGACCACAAAGATGAACAGCGCCAGGAGCCAGGGACC
CACCGGATATTGACCCTCTTTCGTTTTCGAGGATTTGGGTACATTGCCAC
GCATTGTCACATATTTGCTGGCCTTCTCGTTAGCGACGCGCATTCTCTGT
GGTGGAGCCATGTCGACTGATAACT
BS16175.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:52:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32276-PA | 195 | CG32276-RA | 1..195 | 211..17 | 975 | 100 | Minus |
CG32276-PB | 195 | CG32276-RB | 1..195 | 211..17 | 975 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 19:11:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32276-RB | 739 | CG32276-RB | 87..281 | 211..17 | 975 | 100 | Minus |
CG32276-RA | 865 | CG32276-RA | 213..407 | 211..17 | 975 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 19:11:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 3198321..3198432 | 17..128 | 560 | 100 | Plus |
3L | 28110227 | 3L | 3198752..3198835 | 128..211 | 420 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-11 19:11:08 has no hits.
BS16175.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:02:45 Download gff for
BS16175.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32276-PB | 1..195 | 17..211 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-27 05:12:20 Download gff for
BS16175.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32276-RA | 208..407 | 17..218 | 98 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 00:08:56 Download gff for
BS16175.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32276-RA | 208..407 | 17..218 | 98 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 00:08:56 Download gff for
BS16175.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3198321..3198431 | 17..127 | 100 | <- | Plus |
3L | 3198752..3198840 | 128..218 | 95 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-27 05:12:20 Download gff for
BS16175.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 3198321..3198431 | 17..127 | 100 | <- | Plus |
arm_3L | 3198752..3198840 | 128..218 | 95 | | Plus |
BS16175.5prime Sequence
225 bp (225 high quality bases) assembled on 2007-04-16
> BS16175.5prime
GAAGTTATCAGTCGACATGGCTCCACCACAGAGAATGCGCGTCGCTAACG
AGAAGGCCAGCAAATATGTGACAATGCGTGGCAATGTACCCAAATCCTCG
AAAACGAAAGAGGGTCAATATCCGGTGGGTCCCTGGCTCCTGGCGCTGTT
CATCTTTGTGGTCTGCGGCTCTGCCATTTTCCAGATTGTTCAGTCGATAC
GCGCCGCGTAAAAGCTTTCTAGACC
BS16175.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:53:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32276-PA | 195 | CG32276-RA | 1..195 | 17..211 | 975 | 100 | Plus |
CG32276-PB | 195 | CG32276-RB | 1..195 | 17..211 | 975 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 04:40:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32276-RB | 739 | CG32276-RB | 87..281 | 17..211 | 975 | 100 | Plus |
CG32276-RA | 865 | CG32276-RA | 213..407 | 17..211 | 975 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 04:40:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 3198321..3198432 | 211..100 | 560 | 100 | Minus |
3L | 28110227 | 3L | 3198752..3198835 | 100..17 | 420 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-11 04:40:42 has no hits.
BS16175.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:02:46 Download gff for
BS16175.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32276-PB | 1..195 | 17..211 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 09:11:53 Download gff for
BS16175.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32276-RA | 208..407 | 10..211 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:15:18 Download gff for
BS16175.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32276-RA | 208..407 | 10..211 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 09:15:18 Download gff for
BS16175.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3198321..3198431 | 101..211 | 100 | <- | Minus |
3L | 3198752..3198840 | 10..100 | 95 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 09:11:53 Download gff for
BS16175.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 3198321..3198431 | 101..211 | 100 | <- | Minus |
arm_3L | 3198752..3198840 | 10..100 | 95 | | Minus |
BS16175.pep Sequence
Translation from 16 to 210
> BS16175.pep
MAPPQRMRVANEKASKYVTMRGNVPKSSKTKEGQYPVGPWLLALFIFVVC
GSAIFQIVQSIRAA*
BS16175.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:25:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32276-PB | 64 | CG32276-PB | 1..64 | 1..64 | 327 | 100 | Plus |
CG32276-PA | 64 | CG32276-PA | 1..64 | 1..64 | 327 | 100 | Plus |