Clone BS16206 Report

Search the DGRC for BS16206

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:162
Well:6
Vector:pDNR-Dual
Associated Gene/Transcriptlawc-RA
Protein status:BS16206.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS16206.3prime Sequence

252 bp (252 high quality bases) assembled on 2007-05-15

> BS16206.3prime
ATGGTCTAGAAAGCTTCTATAGAAACGTTAAGCAGCGGCAGTAGCAGCAA
CAAGAACAACAGCAGCAACAACAACTACTACAACGAACAGAGACGACGTC
GAAGGAAAGATTTTTACTCGCGTCGCGGTATACTTCAACTGTTTTTGAAC
TTTTATTGCGTGTTTGCTGCTGCGACAAAACTTGCGCGGCGCCACAAAGC
GGAGAAAACGTTGACCGCGTGTGTGTGGCGGAGAGCATGTCGACTGATAA
CT

BS16206.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 16:23:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG32711-PA 222 CG32711-RA 1..222 238..17 1110 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 12:05:02
Subject Length Description Subject Range Query Range Score Percent Strand
lawc-RA 1072 CG32711-RA 124..346 239..17 1115 100 Minus
lawc-RB 1332 CG32711-RB 124..346 239..17 1115 100 Minus
lawc-RD 1870 CG32711-RD 124..346 239..17 1115 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 12:05:01
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8409753..8409975 17..239 1115 100 Plus
Blast to na_te.dros performed on 2015-02-13 12:05:02 has no hits.

BS16206.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 16:23:51 Download gff for BS16206.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32711-PA 1..222 17..238 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 17:57:11 Download gff for BS16206.3prime
Subject Subject Range Query Range Percent Splice Strand
lawc-RD 120..353 9..245 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 14:24:22 Download gff for BS16206.3prime
Subject Subject Range Query Range Percent Splice Strand
lawc-RD 120..353 9..245 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 14:24:22 Download gff for BS16206.3prime
Subject Subject Range Query Range Percent Splice Strand
X 8409746..8409979 9..245 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 17:57:11 Download gff for BS16206.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 8303779..8304012 9..245 97   Plus

BS16206.5prime Sequence

252 bp (252 high quality bases) assembled on 2007-05-15

> BS16206.5prime
GAAGTTATCAGTCGACATGCTCTCCGCCACACACACGCGGTCAACGTTTT
CTCCGCTTTGTGGCGCCGCGCAAGTTTTGTCGCAGCAGCAAACACGCAAT
AAAAGTTCAAAAACAGTTGAAGTATACCGCGACGCGAGTAAAAATCTTTC
CTTCGACGTCGTCTCTGTTCGTTGTAGTAGTTGTTGTTGCTGCTGTTGTT
CTTGTTGCTGCTACTGCCGCTGCTTAACGTTTCTATAGAAGCTTTCTAGA
CC

BS16206.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 16:18:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG32711-PA 222 CG32711-RA 1..222 17..238 1110 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 16:01:38
Subject Length Description Subject Range Query Range Score Percent Strand
lawc-RA 1072 CG32711-RA 124..346 16..238 1115 100 Plus
lawc-RB 1332 CG32711-RB 124..346 16..238 1115 100 Plus
lawc-RD 1870 CG32711-RD 124..346 16..238 1115 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 16:01:32
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8409753..8409975 238..16 1115 100 Minus
Blast to na_te.dros performed on 2015-02-10 16:01:35 has no hits.

BS16206.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 16:18:38 Download gff for BS16206.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32711-PA 1..222 17..238 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 02:35:54 Download gff for BS16206.5prime
Subject Subject Range Query Range Percent Splice Strand
lawc-RD 120..353 10..246 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:27:06 Download gff for BS16206.5prime
Subject Subject Range Query Range Percent Splice Strand
lawc-RD 120..353 10..246 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:27:06 Download gff for BS16206.5prime
Subject Subject Range Query Range Percent Splice Strand
X 8409746..8409979 10..246 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 02:35:54 Download gff for BS16206.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 8303779..8304012 10..246 97   Minus

BS16206.complete Sequence

254 bp assembled on 2007-05-07

GenBank Submission: FJ638090

> BS16206.complete
GAAGTTATCAGTCGACATGCTCTCCGCCACACACACGCGGTCAACGTTTT
CTCCGCTTTGTGGCGCCGCGCAAGTTTTGTCGCAGCAGCAAACACGCAAT
AAAAGTTCAAAAACAGTTGAAGTATACCGCGACGCGAGTAAAAATCTTTC
CTTCGACGTCGTCTCTGTTCGTTGTAGTAGTTGTTGTTGCTGCTGTTGTT
CTTGTTGCTGCTACTGCCGCTGCTTAACGTTTCTATAGAAGCTTTCTAGA
CCAT

BS16206.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:00:46
Subject Length Description Subject Range Query Range Score Percent Strand
lawc-RA 222 CG32711-PA 1..222 17..238 1110 100 Plus
lawc-RB 222 CG32711-PB 1..222 17..238 1110 100 Plus
lawc-RD 222 CG32711-PD 1..222 17..238 1110 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:00:47
Subject Length Description Subject Range Query Range Score Percent Strand
lawc-RA 1072 CG32711-RA 124..346 16..238 1115 100 Plus
lawc-RB 1332 CG32711-RB 124..346 16..238 1115 100 Plus
lawc-RD 1870 CG32711-RD 124..346 16..238 1115 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:00:45
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8409753..8409975 238..16 1115 100 Minus
Blast to na_te.dros performed on 2014-11-27 16:00:46 has no hits.

BS16206.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:12:15 Download gff for BS16206.complete
Subject Subject Range Query Range Percent Splice Strand
CG32711-RA 1..222 17..238 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:13:37 Download gff for BS16206.complete
Subject Subject Range Query Range Percent Splice Strand
CG32711-RA 117..350 10..246 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:47:37 Download gff for BS16206.complete
Subject Subject Range Query Range Percent Splice Strand
lawc-RD 125..346 17..238 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed on 2008-07-21 14:12:16 has no hits.
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:08:15 Download gff for BS16206.complete
Subject Subject Range Query Range Percent Splice Strand
lawc-RD 125..346 17..238 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:08:15 Download gff for BS16206.complete
Subject Subject Range Query Range Percent Splice Strand
X 8409753..8409974 17..238 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:47:37 Download gff for BS16206.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 8303786..8304007 17..238 100   Minus

BS16206.pep Sequence

Translation from 16 to 237

> BS16206.pep
MLSATHTRSTFSPLCGAAQVLSQQQTRNKSSKTVEVYRDASKNLSFDVVS
VRCSSCCCCCCSCCCYCRCLTFL*

BS16206.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:32:58
Subject Length Description Subject Range Query Range Score Percent Strand
lawc-PA 73 CG32711-PA 1..73 1..73 406 100 Plus
lawc-PB 73 CG32711-PB 1..73 1..73 406 100 Plus
lawc-PD 73 CG32711-PD 1..73 1..73 406 100 Plus
lawc-PC 73 CG32711-PC 1..73 1..73 406 100 Plus