Clone BS16405 Report

Search the DGRC for BS16405

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:164
Well:5
Vector:pDNR-Dual
Associated Gene/TranscriptCG30055-RA
Protein status:BS16405.pep: validated full length
Sequenced Size:16

Clone Sequence Records

BS16405.3prime Sequence

201 bp (201 high quality bases) assembled on 2007-05-15

> BS16405.3prime
ATGGTCTAGAAAGCTTTTAGTTGCATGTGAACTTTGAACTTTCGAGCTGG
AAAGTGGAAGGCGGATTTGCATTTCCTATCGCTGCAGGTGTCTCACAAAG
AGAGAGGCTCTCTCGTATCCTCCGCCCCCGCTGCATTTTTTTCATTGCGC
AATGAGCGAGACGAATCGATAACTGCAAGGTTTCCATGTCGACTGATAAC
T

BS16405.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 16:45:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG30055-PA 171 CG30055-RA 1..171 187..17 855 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed on 2015-02-12 15:55:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 15:55:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12590064..12590236 189..17 865 100 Minus
Blast to na_te.dros performed on 2015-02-12 15:55:06 has no hits.

BS16405.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 16:45:23 Download gff for BS16405.3prime
Subject Subject Range Query Range Percent Splice Strand
CG30055-PA 1..171 17..187 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 18:26:39 Download gff for BS16405.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 12590064..12590245 8..189 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 18:26:39 Download gff for BS16405.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 12590064..12590245 8..189 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 15:19:40 Download gff for BS16405.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8477569..8477750 8..189 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 15:19:40 Download gff for BS16405.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8477569..8477750 8..189 97   Minus

BS16405.5prime Sequence

201 bp (201 high quality bases) assembled on 2007-05-15

> BS16405.5prime
GAAGTTATCAGTCGACATGGAAACCTTGCAGTTATCGATTCGTCTCGCTC
ATTGCGCAATGAAAAAAATGCAGCGGGGGCGGAGGATACGAGAGAGCCTC
TCTCTTTGTGAGACACCTGCAGCGATAGGAAATGCAAATCCGCCTTCCAC
TTTCCAGCTCGAAAGTTCAAAGTTCACATGCAACTAAAAGCTTTCTAGAC
C

BS16405.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 16:40:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG30055-PA 171 CG30055-RA 1..171 17..187 855 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed on 2015-02-10 15:00:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 15:00:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12590064..12590236 15..187 865 100 Plus
Blast to na_te.dros performed on 2015-02-10 15:00:30 has no hits.

BS16405.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 16:40:30 Download gff for BS16405.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30055-PA 1..171 17..187 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:12:28 Download gff for BS16405.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 12590064..12590245 15..196 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:12:28 Download gff for BS16405.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 12590064..12590245 15..196 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-15 06:19:29 Download gff for BS16405.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8477569..8477750 15..196 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-15 06:19:29 Download gff for BS16405.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8477569..8477750 15..196 97   Plus

BS16405.complete Sequence

203 bp assembled on 2007-05-07

GenBank Submission: FJ638138

> BS16405.complete
GAAGTTATCAGTCGACATGGAAACCTTGCAGTTATCGATTCGTCTCGCTC
ATTGCGCAATGAAAAAAATGCAGCGGGGGCGGAGGATACGAGAGAGCCTC
TCTCTTTGTGAGACACCTGCAGCGATAGGAAATGCAAATCCGCCTTCCAC
TTTCCAGCTCGAAAGTTCAAAGTTCACATGCAACTAAAAGCTTTCTAGAC
CAT

BS16405.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-27 23:40:23 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-27 23:40:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 23:40:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12590064..12590236 15..187 865 100 Plus
Blast to na_te.dros performed on 2014-11-27 23:40:22 has no hits.

BS16405.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:31:24 Download gff for BS16405.complete
Subject Subject Range Query Range Percent Splice Strand
CG30055-RA 1..171 17..187 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:03:44 Download gff for BS16405.complete
Subject Subject Range Query Range Percent Splice Strand
CG30055-RA 762..943 15..196 97   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:31:24 Download gff for BS16405.complete
Subject Subject Range Query Range Percent Splice Strand
CG30055-RA 762..943 15..196 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:05:50 Download gff for BS16405.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12590066..12590234 17..185 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:05:50 Download gff for BS16405.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12590066..12590234 17..185 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:35:05 Download gff for BS16405.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8477571..8477739 17..185 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:35:05 Download gff for BS16405.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8477571..8477739 17..185 100   Plus

BS16405.pep Sequence

Translation from 16 to 186

> BS16405.pep
METLQLSIRLAHCAMKKMQRGRRIRESLSLCETPAAIGNANPPSTFQLES
SKFTCN*
Sequence BS16405.pep has no blast hits.