Clone BS16407 Report

Search the DGRC for BS16407

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:164
Well:7
Vector:pDNR-Dual
Associated Gene/TranscriptCG13784-RB
Protein status:BS16407.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS16407.5prime Sequence

234 bp (234 high quality bases) assembled on 2007-05-15

> BS16407.5prime
GAAGTTATCAGTCGACATGGATTGGATCATCAACGATGAGATGGGCCTGA
CGGTCGGTCACGTGGTGGGCTGGGCCGCCGCCTCCGCAATGGTTATTGGG
GGCGTGATCCCCTACGTGCCCCAATACATTGAGATCAAAAAAACGCAGGA
CGCGGAGGGATTCTCTCTGTACGTGTGCCTGGCGCTGCTGGTGGCCAACT
CGCTGAGAATACTCTTCTGAAAGCTTTCTAGACC

BS16407.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 16:38:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG13784-PB 203 CG13784-RB 1..203 17..219 940 98.5 Plus
CG13784-PC 783 CG13784-RC 1..203 17..219 940 98.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 22:11:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG13784-RB 1328 CG13784-RB 923..1126 17..220 975 98.5 Plus
CG13784-RF 3749 CG13784-RF 135..337 17..219 970 98.5 Plus
CG13784-RE 3724 CG13784-RE 110..312 17..219 970 98.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 22:11:26
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7218909..7219111 219..17 970 98.5 Minus
Blast to na_te.dros performed on 2015-02-11 22:11:28 has no hits.

BS16407.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 16:38:23 Download gff for BS16407.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13784-PC 1..206 17..226 96   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 02:29:57 Download gff for BS16407.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13784-RB 913..1130 7..225 95   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 00:53:32 Download gff for BS16407.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13784-RB 913..1130 7..225 95   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 00:53:32 Download gff for BS16407.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 7218900..7219121 7..226 95   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 02:29:57 Download gff for BS16407.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7218900..7219121 7..226 95   Minus

BS16407.3prime Sequence

234 bp (234 high quality bases) assembled on 2007-05-15

> BS16407.3prime
ATGGTCTAGAAAGCTTTCAGAAGAGTATTCTCAGCGAGTTGGCCACCAGC
AGCGCCAGGCACACGTACAGAGAGAATCCCTCCGCGTCCTGCGTTTTTTT
GATCTCAATGTATTGGGGCACGTAGGGGATCACGCCCCCAATAACCATTG
CGGAGGCGGCGGCCCAGCCCACCACGTGACCGACCGTCAGGCCCATCTCA
TCGTTGATGATCCAATCCATGTCGACTGATAACT

BS16407.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 16:42:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG13784-PB 203 CG13784-RB 1..203 220..18 940 98.5 Minus
CG13784-PC 783 CG13784-RC 1..203 220..18 940 98.5 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 23:49:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG13784-RB 1328 CG13784-RB 923..1126 220..17 975 98.5 Minus
CG13784-RF 3749 CG13784-RF 135..337 220..18 970 98.5 Minus
CG13784-RE 3724 CG13784-RE 110..312 220..18 970 98.5 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 23:49:50
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7218909..7219111 18..220 970 98.5 Plus
Blast to na_te.dros performed on 2015-02-11 23:49:54 has no hits.

BS16407.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 16:42:48 Download gff for BS16407.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13784-PC 1..206 11..220 96   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 02:30:58 Download gff for BS16407.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13784-RB 913..1130 12..230 95   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 02:00:48 Download gff for BS16407.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13784-RB 913..1130 12..230 95   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 02:00:48 Download gff for BS16407.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 7218900..7219121 11..230 95   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 02:30:58 Download gff for BS16407.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7218900..7219121 11..230 95   Plus

BS16407.complete Sequence

236 bp assembled on 2007-05-07

GenBank Submission: FJ638140

> BS16407.complete
GAAGTTATCAGTCGACATGGATTGGATCATCAACGATGAGATGGGCCTGA
CGGTCGGTCACGTGGTGGGCTGGGCCGCCGCCTCCGCAATGGTTATTGGG
GGCGTGATCCCCTACGTGCCCCAATACATTGAGATCAAAAAAACGCAGGA
CGCGGAGGGATTCTCTCTGTACGTGTGCCTGGCGCTGCTGGTGGCCAACT
CGCTGAGAATACTCTTCTGAAAGCTTTCTAGACCAT

BS16407.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:39:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG13784-RB 204 CG13784-PB 1..204 17..220 975 98.5 Plus
CG13784-RF 2520 CG13784-PF 1..203 17..219 970 98.5 Plus
CG13784-RE 2520 CG13784-PE 1..203 17..219 970 98.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:39:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG13784-RB 1328 CG13784-RB 923..1126 17..220 975 98.5 Plus
CG13784-RF 3749 CG13784-RF 135..337 17..219 970 98.5 Plus
CG13784-RE 3724 CG13784-RE 110..312 17..219 970 98.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:39:46
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7218909..7219111 219..17 970 98.5 Minus
Blast to na_te.dros performed on 2014-11-27 07:39:47 has no hits.

BS16407.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:31:27 Download gff for BS16407.complete
Subject Subject Range Query Range Percent Splice Strand
CG13784-RC 1..206 17..226 96   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:03:48 Download gff for BS16407.complete
Subject Subject Range Query Range Percent Splice Strand
CG13784-RB 909..1126 7..225 95   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:19:56 Download gff for BS16407.complete
Subject Subject Range Query Range Percent Splice Strand
CG13784-RB 923..1125 17..219 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:31:27 Download gff for BS16407.complete
Subject Subject Range Query Range Percent Splice Strand
CG13784-RB 909..1126 7..225 95   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:14:50 Download gff for BS16407.complete
Subject Subject Range Query Range Percent Splice Strand
CG13784-RB 923..1125 17..219 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:14:50 Download gff for BS16407.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7218909..7219111 17..219 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:19:56 Download gff for BS16407.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7218909..7219111 17..219 98   Minus

BS16407.pep Sequence

Translation from 16 to 219

> BS16407.pep
MDWIINDEMGLTVGHVVGWAAASAMVIGGVIPYVPQYIEIKKTQDAEGFS
LYVCLALLVANSLRILF*

BS16407.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:24:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG13784-PB 67 CG13784-PB 1..67 1..67 345 100 Plus
CG13784-PD 275 CG13784-PD 1..67 1..67 345 100 Plus
CG13784-PC 283 CG13784-PC 1..67 1..67 345 100 Plus
CG13784-PE 839 CG13784-PE 1..67 1..67 345 100 Plus
CG13784-PF 969 CG13784-PF 1..67 1..67 345 100 Plus