Clone Sequence Records
BS16407.5prime Sequence
234 bp (234 high quality bases) assembled on 2007-05-15
> BS16407.5prime
GAAGTTATCAGTCGACATGGATTGGATCATCAACGATGAGATGGGCCTGA
CGGTCGGTCACGTGGTGGGCTGGGCCGCCGCCTCCGCAATGGTTATTGGG
GGCGTGATCCCCTACGTGCCCCAATACATTGAGATCAAAAAAACGCAGGA
CGCGGAGGGATTCTCTCTGTACGTGTGCCTGGCGCTGCTGGTGGCCAACT
CGCTGAGAATACTCTTCTGAAAGCTTTCTAGACC
BS16407.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 16:38:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13784-PB | 203 | CG13784-RB | 1..203 | 17..219 | 940 | 98.5 | Plus |
CG13784-PC | 783 | CG13784-RC | 1..203 | 17..219 | 940 | 98.5 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 22:11:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13784-RB | 1328 | CG13784-RB | 923..1126 | 17..220 | 975 | 98.5 | Plus |
CG13784-RF | 3749 | CG13784-RF | 135..337 | 17..219 | 970 | 98.5 | Plus |
CG13784-RE | 3724 | CG13784-RE | 110..312 | 17..219 | 970 | 98.5 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 22:11:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 7218909..7219111 | 219..17 | 970 | 98.5 | Minus |
Blast to na_te.dros performed on 2015-02-11 22:11:28 has no hits.
BS16407.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 16:38:23 Download gff for
BS16407.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13784-PC | 1..206 | 17..226 | 96 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 02:29:57 Download gff for
BS16407.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13784-RB | 913..1130 | 7..225 | 95 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 00:53:32 Download gff for
BS16407.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13784-RB | 913..1130 | 7..225 | 95 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 00:53:32 Download gff for
BS16407.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 7218900..7219121 | 7..226 | 95 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 02:29:57 Download gff for
BS16407.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 7218900..7219121 | 7..226 | 95 | | Minus |
BS16407.3prime Sequence
234 bp (234 high quality bases) assembled on 2007-05-15
> BS16407.3prime
ATGGTCTAGAAAGCTTTCAGAAGAGTATTCTCAGCGAGTTGGCCACCAGC
AGCGCCAGGCACACGTACAGAGAGAATCCCTCCGCGTCCTGCGTTTTTTT
GATCTCAATGTATTGGGGCACGTAGGGGATCACGCCCCCAATAACCATTG
CGGAGGCGGCGGCCCAGCCCACCACGTGACCGACCGTCAGGCCCATCTCA
TCGTTGATGATCCAATCCATGTCGACTGATAACT
BS16407.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 16:42:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13784-PB | 203 | CG13784-RB | 1..203 | 220..18 | 940 | 98.5 | Minus |
CG13784-PC | 783 | CG13784-RC | 1..203 | 220..18 | 940 | 98.5 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 23:49:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13784-RB | 1328 | CG13784-RB | 923..1126 | 220..17 | 975 | 98.5 | Minus |
CG13784-RF | 3749 | CG13784-RF | 135..337 | 220..18 | 970 | 98.5 | Minus |
CG13784-RE | 3724 | CG13784-RE | 110..312 | 220..18 | 970 | 98.5 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 23:49:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 7218909..7219111 | 18..220 | 970 | 98.5 | Plus |
Blast to na_te.dros performed on 2015-02-11 23:49:54 has no hits.
BS16407.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 16:42:48 Download gff for
BS16407.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13784-PC | 1..206 | 11..220 | 96 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 02:30:58 Download gff for
BS16407.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13784-RB | 913..1130 | 12..230 | 95 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 02:00:48 Download gff for
BS16407.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13784-RB | 913..1130 | 12..230 | 95 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 02:00:48 Download gff for
BS16407.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 7218900..7219121 | 11..230 | 95 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 02:30:58 Download gff for
BS16407.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 7218900..7219121 | 11..230 | 95 | | Plus |
BS16407.complete Sequence
236 bp assembled on 2007-05-07
GenBank Submission: FJ638140
> BS16407.complete
GAAGTTATCAGTCGACATGGATTGGATCATCAACGATGAGATGGGCCTGA
CGGTCGGTCACGTGGTGGGCTGGGCCGCCGCCTCCGCAATGGTTATTGGG
GGCGTGATCCCCTACGTGCCCCAATACATTGAGATCAAAAAAACGCAGGA
CGCGGAGGGATTCTCTCTGTACGTGTGCCTGGCGCTGCTGGTGGCCAACT
CGCTGAGAATACTCTTCTGAAAGCTTTCTAGACCAT
BS16407.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:39:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13784-RB | 204 | CG13784-PB | 1..204 | 17..220 | 975 | 98.5 | Plus |
CG13784-RF | 2520 | CG13784-PF | 1..203 | 17..219 | 970 | 98.5 | Plus |
CG13784-RE | 2520 | CG13784-PE | 1..203 | 17..219 | 970 | 98.5 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:39:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13784-RB | 1328 | CG13784-RB | 923..1126 | 17..220 | 975 | 98.5 | Plus |
CG13784-RF | 3749 | CG13784-RF | 135..337 | 17..219 | 970 | 98.5 | Plus |
CG13784-RE | 3724 | CG13784-RE | 110..312 | 17..219 | 970 | 98.5 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:39:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 7218909..7219111 | 219..17 | 970 | 98.5 | Minus |
Blast to na_te.dros performed on 2014-11-27 07:39:47 has no hits.
BS16407.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:31:27 Download gff for
BS16407.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13784-RC | 1..206 | 17..226 | 96 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:03:48 Download gff for
BS16407.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13784-RB | 909..1126 | 7..225 | 95 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:19:56 Download gff for
BS16407.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13784-RB | 923..1125 | 17..219 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:31:27 Download gff for
BS16407.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13784-RB | 909..1126 | 7..225 | 95 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:14:50 Download gff for
BS16407.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13784-RB | 923..1125 | 17..219 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:14:50 Download gff for
BS16407.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 7218909..7219111 | 17..219 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:19:56 Download gff for
BS16407.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 7218909..7219111 | 17..219 | 98 | | Minus |
BS16407.pep Sequence
Translation from 16 to 219
> BS16407.pep
MDWIINDEMGLTVGHVVGWAAASAMVIGGVIPYVPQYIEIKKTQDAEGFS
LYVCLALLVANSLRILF*
BS16407.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:24:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13784-PB | 67 | CG13784-PB | 1..67 | 1..67 | 345 | 100 | Plus |
CG13784-PD | 275 | CG13784-PD | 1..67 | 1..67 | 345 | 100 | Plus |
CG13784-PC | 283 | CG13784-PC | 1..67 | 1..67 | 345 | 100 | Plus |
CG13784-PE | 839 | CG13784-PE | 1..67 | 1..67 | 345 | 100 | Plus |
CG13784-PF | 969 | CG13784-PF | 1..67 | 1..67 | 345 | 100 | Plus |