Clone BS16409 Report

Search the DGRC for BS16409

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:164
Well:9
Vector:pDNR-Dual
Associated Gene/Transcriptbc10-RA
Protein status:BS16409.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS16409.5prime Sequence

270 bp (270 high quality bases) assembled on 2007-05-15

> BS16409.5prime
GAAGTTATCAGTCGACATGTATTGCCTACAATGCCTGCTGCCCGTACTAC
TGATACCGAAACCCTCGAATCCGGCCCTGATGGAAACGCACGTGATGTTC
ATAGTCCTCTACCTGGTCGGATTCTTCCTGGAGCGAAAGCCCTGCACCAT
CTGCAGCCTCGTATTCCTCACAGCCGTATCCCTGATATGCTACAGTGGCG
TCGGGAACTGCATATTTTGGGGCAACTGCGAGGGCCATCAATGTGAGAAT
GGCTAGAAGCTTTCTAGACC

BS16409.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 16:38:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG4867-PA 240 bc10-RA 1..240 17..256 1200 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 15:29:44
Subject Length Description Subject Range Query Range Score Percent Strand
bc10-RA 1380 CG4867-RA 240..480 17..257 1205 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 15:29:41
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 5565625..5565865 17..257 1205 100 Plus
Blast to na_te.dros performed on 2015-02-13 15:29:42 has no hits.

BS16409.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 16:38:36 Download gff for BS16409.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4867-PA 1..240 17..256 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 11:17:11 Download gff for BS16409.5prime
Subject Subject Range Query Range Percent Splice Strand
bc10-RA 232..480 9..257 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 17:00:19 Download gff for BS16409.5prime
Subject Subject Range Query Range Percent Splice Strand
bc10-RA 232..480 9..257 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 17:00:19 Download gff for BS16409.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 5565617..5565865 9..257 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 11:17:11 Download gff for BS16409.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 5558717..5558965 9..257 98   Plus

BS16409.3prime Sequence

270 bp (270 high quality bases) assembled on 2007-05-15

> BS16409.3prime
ATGGTCTAGAAAGCTTCTAGCCATTCTCACATTGATGGCCCTCGCAGTTG
CCCCAAAATATGCAGTTCCCGACGCCACTGTAGCATATCAGGGATACGGC
TGTGAGGAATACGAGGCTGCAGATGGTGCAGGGCTTTCGCTCCAGGAAGA
ATCCGACCAGGTAGAGGACTATGAACATCACGTGCGTTTCCATCAGGGCC
GGATTCGAGGGTTTCGGTATCAGTAGTACGGGCAGCAGGCATTGTAGGCA
ATACATGTCGACTGATAACT

BS16409.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 16:43:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG4867-PA 240 bc10-RA 1..240 256..17 1200 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:53:30
Subject Length Description Subject Range Query Range Score Percent Strand
bc10-RA 1380 CG4867-RA 240..480 256..16 1205 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:53:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 5565625..5565865 256..16 1205 100 Minus
Blast to na_te.dros performed on 2015-02-12 10:53:29 has no hits.

BS16409.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 16:43:02 Download gff for BS16409.3prime
Subject Subject Range Query Range Percent Splice Strand
CG4867-PA 1..240 17..256 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 20:51:47 Download gff for BS16409.3prime
Subject Subject Range Query Range Percent Splice Strand
bc10-RA 232..480 16..264 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:35:29 Download gff for BS16409.3prime
Subject Subject Range Query Range Percent Splice Strand
bc10-RA 232..480 16..264 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:35:29 Download gff for BS16409.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 5565617..5565865 16..264 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 20:51:47 Download gff for BS16409.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 5558717..5558965 16..264 98   Minus

BS16409.complete Sequence

272 bp assembled on 2007-05-07

GenBank Submission: FJ638142

> BS16409.complete
GAAGTTATCAGTCGACATGTATTGCCTACAATGCCTGCTGCCCGTACTAC
TGATACCGAAACCCTCGAATCCGGCCCTGATGGAAACGCACGTGATGTTC
ATAGTCCTCTACCTGGTCGGATTCTTCCTGGAGCGAAAGCCCTGCACCAT
CTGCAGCCTCGTATTCCTCACAGCCGTATCCCTGATATGCTACAGTGGCG
TCGGGAACTGCATATTTTGGGGCAACTGCGAGGGCCATCAATGTGAGAAT
GGCTAGAAGCTTTCTAGACCAT

BS16409.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:53:16
Subject Length Description Subject Range Query Range Score Percent Strand
bc10-RA 240 CG4867-PA 1..240 17..256 1200 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:53:18
Subject Length Description Subject Range Query Range Score Percent Strand
bc10-RA 1380 CG4867-RA 240..480 17..257 1205 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:53:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 5565625..5565865 17..257 1205 100 Plus
Blast to na_te.dros performed on 2014-11-28 00:53:15 has no hits.

BS16409.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:15:11 Download gff for BS16409.complete
Subject Subject Range Query Range Percent Splice Strand
bc10-RA 229..477 9..257 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:33:32 Download gff for BS16409.complete
Subject Subject Range Query Range Percent Splice Strand
bc10-RA 240..479 17..256 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:39:53 Download gff for BS16409.complete
Subject Subject Range Query Range Percent Splice Strand
bc10-RA 240..479 17..256 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:39:53 Download gff for BS16409.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5565625..5565864 17..256 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:33:32 Download gff for BS16409.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 5558725..5558964 17..256 100   Plus

BS16409.pep Sequence

Translation from 16 to 255

> BS16409.pep
MYCLQCLLPVLLIPKPSNPALMETHVMFIVLYLVGFFLERKPCTICSLVF
LTAVSLICYSGVGNCIFWGNCEGHQCENG*

BS16409.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:32:56
Subject Length Description Subject Range Query Range Score Percent Strand
bc10-PA 79 CG4867-PA 1..79 1..79 440 100 Plus