Clone Sequence Records
BS16518.5prime Sequence
255 bp (255 high quality bases) assembled on 2007-05-15
> BS16518.5prime
GAAGTTATCAGTCGACATGAAGCGCGGTACCATTATGGTGTGCTTGGAAC
CGCCATCGTTTACTTCAAAGGACTTGGACACCCGTTTCTCCTCCTCGGGA
TCTTCCACATCACGCTGCACCAAATCGAAATCAAATTCATCAAAGCGAAT
TCTTCGCAGCTCCGGTTACACAGAGCTGAACAGCAACTCGACTACTCTGC
TGTCCAGCGAGGACGAACTTACTCCGCGTCAGCGCCTCTAGAAGCTTTCT
AGACC
BS16518.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 16:50:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14033-PA | 225 | CG14033-RA | 1..225 | 17..241 | 1125 | 100 | Plus |
CG9203-PA | 2175 | CG9203-RA | 1894..1973 | 95..174 | 200 | 90 | Plus |
CG9203-PA | 2175 | CG9203-RA | 2012..2062 | 186..236 | 180 | 94.1 | Plus |
CG9203-PA | 2175 | CG9203-RA | 1814..1846 | 30..62 | 140 | 96.9 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 16:08:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9203-RA | 2349 | CG9203-RA | 1974..2057 | 91..174 | 285 | 89.3 | Plus |
CG9203-RA | 2349 | CG9203-RA | 2096..2146 | 186..236 | 210 | 94.1 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 16:08:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 5243776..5244000 | 17..241 | 1125 | 100 | Plus |
X | 23542271 | X | 15473096..15473179 | 174..91 | 285 | 89.3 | Minus |
X | 23542271 | X | 15473007..15473057 | 236..186 | 210 | 94.1 | Minus |
Blast to na_te.dros performed on 2015-02-12 16:08:20 has no hits.
BS16518.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 16:50:59 Download gff for
BS16518.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14033-PA | 1..225 | 17..241 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed on 2013-08-30 15:20:54 has no hits.
Sim4 to dmel-all-transcript-r6.02.fasta performed on 2015-02-12 18:44:41 has no hits.
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 18:44:41 Download gff for
BS16518.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 5243771..5244008 | 10..250 | 96 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 15:20:54 Download gff for
BS16518.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 5243771..5244008 | 10..250 | 96 | | Plus |
BS16518.3prime Sequence
255 bp (255 high quality bases) assembled on 2007-05-15
> BS16518.3prime
ATGGTCTAGAAAGCTTCTAGAGGCGCTGACGCGGAGTAAGTTCGTCCTCG
CTGGACAGCAGAGTAGTCGAGTTGCTGTTCAGCTCTGTGTAACCGGAGCT
GCGAAGAATTCGCTTTGATGAATTTGATTTCGATTTGGTGCAGCGTGATG
TGGAAGATCCCGAGGAGGAGAAACGGGTGTCCAAGTCCTTTGAAGTAAAC
GATGGCGGTTCCAAGCACACCATAATGGTACCGCGCTTCATGTCGACTGA
TAACT
BS16518.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 16:56:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14033-PA | 225 | CG14033-RA | 1..225 | 241..17 | 1125 | 100 | Minus |
CG9203-PA | 2175 | CG9203-RA | 1894..1973 | 163..84 | 200 | 90 | Minus |
CG9203-PA | 2175 | CG9203-RA | 2012..2062 | 72..22 | 180 | 94.1 | Minus |
CG9203-PA | 2175 | CG9203-RA | 1814..1846 | 228..196 | 140 | 96.9 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 13:12:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9203-RA | 2349 | CG9203-RA | 1974..2057 | 167..84 | 285 | 89.3 | Minus |
CG9203-RA | 2349 | CG9203-RA | 2096..2146 | 72..22 | 210 | 94.1 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 13:12:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 5243776..5244000 | 241..17 | 1125 | 100 | Minus |
X | 23542271 | X | 15473096..15473179 | 84..167 | 285 | 89.3 | Plus |
X | 23542271 | X | 15473007..15473057 | 22..72 | 210 | 94.1 | Plus |
Blast to na_te.dros performed on 2015-02-13 13:12:56 has no hits.
BS16518.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 16:56:36 Download gff for
BS16518.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14033-PA | 1..225 | 17..241 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed on 2013-09-02 17:40:12 has no hits.
Sim4 to dmel-all-transcript-r6.02.fasta performed on 2015-02-13 15:40:47 has no hits.
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 15:40:47 Download gff for
BS16518.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 5243771..5244008 | 8..248 | 96 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 17:40:12 Download gff for
BS16518.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 5243771..5244008 | 8..248 | 96 | | Minus |
BS16518.complete Sequence
257 bp assembled on 2007-05-07
GenBank Submission: FJ638157
> BS16518.complete
GAAGTTATCAGTCGACATGAAGCGCGGTACCATTATGGTGTGCTTGGAAC
CGCCATCGTTTACTTCAAAGGACTTGGACACCCGTTTCTCCTCCTCGGGA
TCTTCCACATCACGCTGCACCAAATCGAAATCAAATTCATCAAAGCGAAT
TCTTCGCAGCTCCGGTTACACAGAGCTGAACAGCAACTCGACTACTCTGC
TGTCCAGCGAGGACGAACTTACTCCGCGTCAGCGCCTCTAGAAGCTTTCT
AGACCAT
BS16518.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:11:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9203-RA | 2175 | CG9203-PA | 1890..1973 | 91..174 | 285 | 89.3 | Plus |
CG9203-RA | 2175 | CG9203-PA | 2012..2062 | 186..236 | 210 | 94.1 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:11:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9203-RA | 2349 | CG9203-RA | 1974..2057 | 91..174 | 285 | 89.3 | Plus |
CG9203-RA | 2349 | CG9203-RA | 2096..2146 | 186..236 | 210 | 94.1 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:11:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 5243776..5244000 | 17..241 | 1125 | 100 | Plus |
X | 23542271 | X | 15473096..15473179 | 174..91 | 285 | 89.3 | Minus |
X | 23542271 | X | 15473007..15473057 | 236..186 | 210 | 94.1 | Minus |
Blast to na_te.dros performed on 2014-11-27 13:11:13 has no hits.
BS16518.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:44:33 Download gff for
BS16518.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14033-RA | 1..225 | 17..241 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:31:16 Download gff for
BS16518.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14033-RA | 1065..1302 | 10..250 | 96 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed on 2013-08-04 07:49:07 has no hits.
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:44:33 Download gff for
BS16518.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14033-RA | 1065..1302 | 10..250 | 96 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed on 2014-11-27 14:12:47 has no hits.
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:12:47 Download gff for
BS16518.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 5243776..5244000 | 17..241 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:49:07 Download gff for
BS16518.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 5243776..5244000 | 17..241 | 100 | | Plus |
BS16518.pep Sequence
Translation from 16 to 240
> BS16518.pep
MKRGTIMVCLEPPSFTSKDLDTRFSSSGSSTSRCTKSKSNSSKRILRSSG
YTELNSNSTTLLSSEDELTPRQRL*
BS16518.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:38:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9203-PA | 724 | CG9203-PA | 606..687 | 6..73 | 180 | 58.5 | Plus |