Clone BS16533 Report

Search the DGRC for BS16533

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:165
Well:33
Vector:pDNR-Dual
Associated Gene/TranscriptCG17278-RA
Protein status:BS16533.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS16533.3prime Sequence

273 bp (273 high quality bases) assembled on 2007-05-15

> BS16533.3prime
ATGGTCTAGAAAGCTTCTACGGACACTCCTTGTCGCTGATCTTTTGAAAG
TTTGCATTCTGGAGACAATTTTCCGTCTTCATCACGCACAGATTGCGATA
GGTCTTGGTGGAGCCCTTGTCGTCCGCAGCGCAAATGGATCGGTACTCCT
GCGTGTCGCACTCCATGACGCACTTGGTGCTGGGATCGGGCAGGCCGAGG
CACTGGACCAGCGAGAGGGCAAGCAGCGCGATGGCCAACAATACTGCTGA
GAGCTTCATGTCGACTGATAACT

BS16533.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 16:53:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG17278-PA 243 CG17278-RA 1..243 259..17 1165 99.1 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 06:59:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG17278-RA 1934 CG17278-RA 1464..1709 261..16 1200 99.2 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 06:59:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21021405..21021584 52..231 885 99.4 Plus
Blast to na_te.dros performed on 2015-02-13 06:59:55 has no hits.

BS16533.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 16:53:52 Download gff for BS16533.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17278-PA 1..243 17..259 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 20:48:02 Download gff for BS16533.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17278-RA 1464..1712 12..261 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 09:35:25 Download gff for BS16533.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17278-RA 1464..1712 12..261 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 09:35:25 Download gff for BS16533.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 21021266..21021304 12..51 95 <- Plus
3R 21021405..21021584 52..231 99 <- Plus
3R 21022671..21022700 232..261 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 20:48:02 Download gff for BS16533.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16846988..16847026 12..51 95 <- Plus
arm_3R 16847127..16847306 52..231 99 <- Plus
arm_3R 16848393..16848422 232..261 100   Plus

BS16533.5prime Sequence

273 bp (273 high quality bases) assembled on 2007-05-15

> BS16533.5prime
GAAGTTATCAGTCGACATGAAGCTCTCAGCAGTATTGTTGGCCATCGCGC
TGCTTGCCCTCTCGCTGGTCCAGTGCCTCGGCCTGCCCGATCCCAGCACC
AAGTGCGTCATGGAGTGCGACACGCAGGAGTACCGATCCATTTGCGCTGC
GGACGACAAGGGCTCCACCAAGACCTATCGCAATCTGTGCGTGATGAAGA
CGGAAAATTGTCTCCAGAATGCAAACTTTCAAAAGATCAGCGACAAGGAG
TGTCCGTAGAAGCTTTCTAGACC

BS16533.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 16:48:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG17278-PA 243 CG17278-RA 1..243 17..259 1165 99.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 02:44:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG17278-RA 1934 CG17278-RA 1464..1709 15..260 1200 99.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 02:44:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21021405..21021584 224..45 885 99.4 Minus
Blast to na_te.dros performed on 2015-02-11 02:44:25 has no hits.

BS16533.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 16:48:25 Download gff for BS16533.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17278-PA 1..243 17..259 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-22 21:01:36 Download gff for BS16533.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17278-RA 1464..1712 15..264 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 05:25:56 Download gff for BS16533.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17278-RA 1464..1712 15..264 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 05:25:56 Download gff for BS16533.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 21021266..21021304 225..264 95 <- Minus
3R 21021405..21021584 45..224 99 <- Minus
3R 21022671..21022700 15..44 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-22 21:01:36 Download gff for BS16533.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16846988..16847026 225..264 95 <- Minus
arm_3R 16847127..16847306 45..224 99 <- Minus
arm_3R 16848393..16848422 15..44 100   Minus

BS16533.complete Sequence

275 bp assembled on 2007-05-07

GenBank Submission: FJ638162

> BS16533.complete
GAAGTTATCAGTCGACATGAAGCTCTCAGCAGTATTGTTGGCCATCGCGC
TGCTTGCCCTCTCGCTGGTCCAGTGCCTCGGCCTGCCCGATCCCAGCACC
AAGTGCGTCATGGAGTGCGACACGCAGGAGTACCGATCCATTTGCGCTGC
GGACGACAAGGGCTCCACCAAGACCTATCGCAATCTGTGCGTGATGAAGA
CGGAAAATTGTCTCCAGAATGCAAACTTTCAAAAGATCAGCGACAAGGAG
TGTCCGTAGAAGCTTTCTAGACCAT

BS16533.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:34:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG17278-RA 243 CG17278-PA 1..243 17..259 1185 99.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:34:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG17278-RA 1934 CG17278-RA 1464..1709 15..260 1200 99.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:34:02
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21021405..21021584 224..45 885 99.4 Minus
Blast to na_te.dros performed on 2014-11-27 10:34:03 has no hits.

BS16533.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:46:29 Download gff for BS16533.complete
Subject Subject Range Query Range Percent Splice Strand
CG17278-RA 1..243 17..259 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:34:10 Download gff for BS16533.complete
Subject Subject Range Query Range Percent Splice Strand
CG17278-RA 1464..1712 15..264 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:19:21 Download gff for BS16533.complete
Subject Subject Range Query Range Percent Splice Strand
CG17278-RA 1466..1708 17..259 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:46:29 Download gff for BS16533.complete
Subject Subject Range Query Range Percent Splice Strand
CG17278-RA 1464..1712 15..264 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:25:14 Download gff for BS16533.complete
Subject Subject Range Query Range Percent Splice Strand
CG17278-RA 1466..1708 17..259 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:25:14 Download gff for BS16533.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21021405..21021584 45..224 99 <- Minus
3R 21022671..21022698 17..44 100   Minus
3R 21021270..21021304 225..259 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:19:21 Download gff for BS16533.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16846992..16847026 225..259 97 <- Minus
arm_3R 16847127..16847306 45..224 99 <- Minus
arm_3R 16848393..16848420 17..44 100   Minus

BS16533.pep Sequence

Translation from 16 to 258

> BS16533.pep
MKLSAVLLAIALLALSLVQCLGLPDPSTKCVMECDTQEYRSICAADDKGS
TKTYRNLCVMKTENCLQNANFQKISDKECP*

BS16533.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:16:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG17278-PA 80 CG17278-PA 1..80 1..80 419 100 Plus