Clone BS16561 Report

Search the DGRC for BS16561

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:165
Well:61
Vector:pDNR-Dual
Associated Gene/TranscriptCG33293-RA
Protein status:BS16561.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS16561.3prime Sequence

291 bp (291 high quality bases) assembled on 2007-05-15

> BS16561.3prime
ATGGTCTAGAAAGCTTTCAAAGACCGCATTCAAAGGGCACAATGTAGTCG
TCTAGCAGCCGCACGCGGCGGAGTCTTCCTTGCGAGTCCACGCCCACGTC
ACCGCCACTGGATGCAGTCTGCTGTCCGACTTTGAGCCCCTCCTCCTCCT
CATTCCTCAGCTCAACCTGGTGTCGCTGCACCACCAACATGCCGGCTGCT
ATTGCCGCCTCCTGGCGCAGCCATCCGGACATGATCCAGACACGGCGAAT
GCAGGTTGTCAGTGCGAATCGTTCCATGTCGACTGATAACT

BS16561.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 16:54:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG33293-PA 261 CG33293-RA 1..261 277..17 1305 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 03:41:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG33293-RA 661 CG33293-RA 111..371 277..17 1305 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 03:41:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5240304..5240564 17..277 1305 100 Plus
Blast to na_te.dros performed on 2015-02-11 03:41:43 has no hits.

BS16561.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 16:54:35 Download gff for BS16561.3prime
Subject Subject Range Query Range Percent Splice Strand
CG33293-PA 1..261 17..277 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 06:25:59 Download gff for BS16561.3prime
Subject Subject Range Query Range Percent Splice Strand
CG33293-RA 105..375 12..282 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 05:28:38 Download gff for BS16561.3prime
Subject Subject Range Query Range Percent Splice Strand
CG33293-RA 105..375 12..282 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 05:28:38 Download gff for BS16561.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 5240300..5240570 12..282 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 06:25:59 Download gff for BS16561.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1066022..1066292 12..282 97   Plus

BS16561.5prime Sequence

291 bp (291 high quality bases) assembled on 2007-05-15

> BS16561.5prime
GAAGTTATCAGTCGACATGGAACGATTCGCACTGACAACCTGCATTCGCC
GTGTCTGGATCATGTCCGGATGGCTGCGCCAGGAGGCGGCAATAGCAGCC
GGCATGTTGGTGGTGCAGCGACACCAGGTTGAGCTGAGGAATGAGGAGGA
GGAGGGGCTCAAAGTCGGACAGCAGACTGCATCCAGTGGCGGTGACGTGG
GCGTGGACTCGCAAGGAAGACTCCGCCGCGTGCGGCTGCTAGACGACTAC
ATTGTGCCCTTTGAATGCGGTCTTTGAAAGCTTTCTAGACC

BS16561.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 16:49:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG33293-PA 261 CG33293-RA 1..261 17..277 1305 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-04 21:02:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG33293-RA 661 CG33293-RA 111..371 17..277 1305 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-04 21:02:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5240304..5240564 277..17 1305 100 Minus
Blast to na_te.dros performed on 2015-02-04 21:02:13 has no hits.

BS16561.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 16:49:05 Download gff for BS16561.5prime
Subject Subject Range Query Range Percent Splice Strand
CG33293-PA 1..261 17..277 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-10 21:38:16 Download gff for BS16561.5prime
Subject Subject Range Query Range Percent Splice Strand
CG33293-RA 105..375 12..282 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-05 00:38:23 Download gff for BS16561.5prime
Subject Subject Range Query Range Percent Splice Strand
CG33293-RA 105..375 12..282 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-05 00:38:23 Download gff for BS16561.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 5240300..5240570 12..282 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-10 21:38:16 Download gff for BS16561.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1066022..1066292 12..282 97   Minus

BS16561.complete Sequence

293 bp assembled on 2007-05-07

GenBank Submission: FJ638165

> BS16561.complete
GAAGTTATCAGTCGACATGGAACGATTCGCACTGACAACCTGCATTCGCC
GTGTCTGGATCATGTCCGGATGGCTGCGCCAGGAGGCGGCAATAGCAGCC
GGCATGTTGGTGGTGCAGCGACACCAGGTTGAGCTGAGGAATGAGGAGGA
GGAGGGGCTCAAAGTCGGACAGCAGACTGCATCCAGTGGCGGTGACGTGG
GCGTGGACTCGCAAGGAAGACTCCGCCGCGTGCGGCTGCTAGACGACTAC
ATTGTGCCCTTTGAATGCGGTCTTTGAAAGCTTTCTAGACCAT

BS16561.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 19:48:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG33293-RA 261 CG33293-PA 1..261 17..277 1305 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 19:48:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG33293-RA 661 CG33293-RA 111..371 17..277 1305 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 19:48:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5240304..5240564 277..17 1305 100 Minus
Blast to na_te.dros performed on 2014-11-27 19:48:29 has no hits.

BS16561.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:30:51 Download gff for BS16561.complete
Subject Subject Range Query Range Percent Splice Strand
CG33293-RA 1..261 17..277 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:54:02 Download gff for BS16561.complete
Subject Subject Range Query Range Percent Splice Strand
CG33293-RA 105..375 12..282 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:59:13 Download gff for BS16561.complete
Subject Subject Range Query Range Percent Splice Strand
CG33293-RA 111..370 17..276 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:30:51 Download gff for BS16561.complete
Subject Subject Range Query Range Percent Splice Strand
CG33293-RA 105..375 12..282 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:08:43 Download gff for BS16561.complete
Subject Subject Range Query Range Percent Splice Strand
CG33293-RA 111..370 17..276 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:08:43 Download gff for BS16561.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5240305..5240564 17..276 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:59:13 Download gff for BS16561.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1066027..1066286 17..276 100   Minus

BS16561.pep Sequence

Translation from 16 to 276

> BS16561.pep
MERFALTTCIRRVWIMSGWLRQEAAIAAGMLVVQRHQVELRNEEEEGLKV
GQQTASSGGDVGVDSQGRLRRVRLLDDYIVPFECGL*

BS16561.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:25:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG33293-PA 86 CG33293-PA 1..86 1..86 441 100 Plus