Clone BS16649 Report

Search the DGRC for BS16649

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:166
Well:49
Vector:pDNR-Dual
Associated Gene/TranscriptsPLA2-RB
Protein status:BS16649.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS16649.5prime Sequence

336 bp (336 high quality bases) assembled on 2007-05-15

> BS16649.5prime
GAAGTTATCAGTCGACATGTGGCTGCTGCGCGAAGCGTTCTTTTTTGGGC
TACTGGCCATGGCTTGGGCCTTCGGCGACGAGGCTATCTTTGAGGACGAG
GACATCTACAACCAGGCACTGCCACCAGTTCCCCATACGGGCATCACGGT
GCCCGGAACCAAGTGGTGCGGACCGGGCAACACGGCGGCGAACTTCGAGG
ATTTGGGCCGCGAACGGGAGACGGACAAGTGCTGTCGTGCCCACGACCAT
TGCGACGAGATTATCGAGTCCCACGGAGCACTCCACGGACTGCCCACCAA
CACAGACTGGTTTCCCATGTAAAAGCTTTCTAGACC

BS16649.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 16:59:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG11124-PB 306 sPLA2-RB 1..306 17..322 1530 100 Plus
CG11124-PA 561 sPLA2-RA 1..302 17..318 1510 100 Plus
CG11124-PC 561 sPLA2-RC 1..302 17..318 1510 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 16:12:00
Subject Length Description Subject Range Query Range Score Percent Strand
sPLA2-RB 725 CG11124-RB 29..337 14..322 1545 100 Plus
sPLA2-RC 897 CG11124-RC 208..512 14..318 1525 100 Plus
sPLA2-RA 718 CG11124-RA 29..333 14..318 1525 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 16:11:59
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7443071..7443379 14..322 1545 100 Plus
Blast to na_te.dros performed on 2015-02-12 16:12:00 has no hits.

BS16649.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 16:59:41 Download gff for BS16649.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11124-PB 1..306 17..322 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 15:17:30 Download gff for BS16649.5prime
Subject Subject Range Query Range Percent Splice Strand
sPLA2-RB 29..339 14..326 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 18:25:31 Download gff for BS16649.5prime
Subject Subject Range Query Range Percent Splice Strand
sPLA2-RB 29..339 14..326 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 18:25:31 Download gff for BS16649.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 7443071..7443381 14..326 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 15:17:30 Download gff for BS16649.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3330576..3330886 14..326 99   Plus

BS16649.3prime Sequence

336 bp (336 high quality bases) assembled on 2007-05-15

> BS16649.3prime
ATGGTCTAGAAAGCTTTTACATGGGAAACCAGTCTGTGTTGGTGGGCAGT
CCGTGGAGTGCTCCGTGGGACTCGATAATCTCGTCGCAATGGTCGTGGGC
ACGACAGCACTTGTCCGTCTCCCGTTCGCGGCCCAAATCCTCGAAGTTCG
CCGCCGTGTTGCCCGGTCCGCACCACTTGGTTCCGGGCACCGTGATGCCC
GTATGGGGAACTGGTGGCAGTGCCTGGTTGTAGATGTCCTCGTCCTCAAA
GATAGCCTCGTCGCCGAAGGCCCAAGCCATGGCCAGTAGCCCAAAAAAGA
ACGCTTCGCGCAGCAGCCACATGTCGACTGATAACT

BS16649.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:03:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG11124-PB 306 sPLA2-RB 1..306 322..17 1530 100 Minus
CG11124-PA 561 sPLA2-RA 1..302 322..21 1510 100 Minus
CG11124-PC 561 sPLA2-RC 1..302 322..21 1510 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 15:46:54
Subject Length Description Subject Range Query Range Score Percent Strand
sPLA2-RB 725 CG11124-RB 29..337 325..17 1545 100 Minus
sPLA2-RC 897 CG11124-RC 208..512 325..21 1525 100 Minus
sPLA2-RA 718 CG11124-RA 29..333 325..21 1525 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 15:46:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7443071..7443379 325..17 1545 100 Minus
Blast to na_te.dros performed on 2015-02-11 15:46:52 has no hits.

BS16649.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:03:55 Download gff for BS16649.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11124-PB 1..306 17..322 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 19:48:54 Download gff for BS16649.3prime
Subject Subject Range Query Range Percent Splice Strand
sPLA2-RB 29..339 13..325 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:23:24 Download gff for BS16649.3prime
Subject Subject Range Query Range Percent Splice Strand
sPLA2-RB 29..339 13..325 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:23:24 Download gff for BS16649.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 7443071..7443381 13..325 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 19:48:54 Download gff for BS16649.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3330576..3330886 13..325 99   Minus

BS16649.complete Sequence

338 bp assembled on 2007-05-07

GenBank Submission: FJ638170

> BS16649.complete
GAAGTTATCAGTCGACATGTGGCTGCTGCGCGAAGCGTTCTTTTTTGGGC
TACTGGCCATGGCTTGGGCCTTCGGCGACGAGGCTATCTTTGAGGACGAG
GACATCTACAACCAGGCACTGCCACCAGTTCCCCATACGGGCATCACGGT
GCCCGGAACCAAGTGGTGCGGACCGGGCAACACGGCGGCGAACTTCGAGG
ATTTGGGCCGCGAACGGGAGACGGACAAGTGCTGTCGTGCCCACGACCAT
TGCGACGAGATTATCGAGTCCCACGGAGCACTCCACGGACTGCCCACCAA
CACAGACTGGTTTCCCATGTAAAAGCTTTCTAGACCAT

BS16649.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:58:36
Subject Length Description Subject Range Query Range Score Percent Strand
sPLA2-RB 306 CG11124-PB 1..306 17..322 1530 100 Plus
sPLA2-RC 561 CG11124-PC 1..302 17..318 1510 100 Plus
sPLA2-RA 561 CG11124-PA 1..302 17..318 1510 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:58:37
Subject Length Description Subject Range Query Range Score Percent Strand
sPLA2-RB 725 CG11124-RB 29..337 14..322 1545 100 Plus
sPLA2-RC 897 CG11124-RC 208..512 14..318 1525 100 Plus
sPLA2-RA 718 CG11124-RA 29..333 14..318 1525 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:58:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7443071..7443379 14..322 1545 100 Plus
Blast to na_te.dros performed on 2014-11-27 10:58:35 has no hits.

BS16649.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:30:42 Download gff for BS16649.complete
Subject Subject Range Query Range Percent Splice Strand
sPLA2-RB 1..306 17..322 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:02:52 Download gff for BS16649.complete
Subject Subject Range Query Range Percent Splice Strand
sPLA2-RB 27..337 14..326 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:43:34 Download gff for BS16649.complete
Subject Subject Range Query Range Percent Splice Strand
sPLA2-RB 32..335 17..320 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:30:43 Download gff for BS16649.complete
Subject Subject Range Query Range Percent Splice Strand
sPLA2-RB 27..337 14..326 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:35:40 Download gff for BS16649.complete
Subject Subject Range Query Range Percent Splice Strand
sPLA2-RB 32..335 17..320 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:35:40 Download gff for BS16649.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7443074..7443377 17..320 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:43:34 Download gff for BS16649.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3330579..3330882 17..320 100   Plus

BS16649.pep Sequence

Translation from 16 to 321

> BS16649.pep
MWLLREAFFFGLLAMAWAFGDEAIFEDEDIYNQALPPVPHTGITVPGTKW
CGPGNTAANFEDLGRERETDKCCRAHDHCDEIIESHGALHGLPTNTDWFP
M*

BS16649.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:25:40
Subject Length Description Subject Range Query Range Score Percent Strand
sPLA2-PB 101 CG11124-PB 1..101 1..101 578 100 Plus
sPLA2-PC 186 CG11124-PC 1..101 1..101 574 99 Plus
sPLA2-PA 186 CG11124-PA 1..101 1..101 574 99 Plus
CG30503-PB 173 CG30503-PB 26..83 43..101 199 62.7 Plus
CG30503-PA 173 CG30503-PA 26..83 43..101 199 62.7 Plus