Clone BS16669 Report

Search the DGRC for BS16669

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:166
Well:69
Vector:pDNR-Dual
Associated Gene/TranscriptSec61beta-RA
Protein status:BS16669.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS16669.3prime Sequence

333 bp (333 high quality bases) assembled on 2007-05-15

> BS16669.3prime
ATGGTCTAGAAAGCTTTTAAGAACGATTGTATTTGCCCCAAATGTGCAGC
ATGAAGACGGAAGCGATGAACAGCAGCGACATGACCAGCACGGGTACGGG
ACCAACTTTGATACCGGGCGAGTCGTCCGTGTAGAAACGCCACATGCCAC
CAGTTCCGGCTCCGCCGGGTGCACGGCTCCGGGCCGCTGTGGTGCTGGTG
GTGGTCTTGCGCTGCTTCAGGGTGCTGCCGCCTCCGGATCCGGCGCTACG
TGGCGCCGACAATTTGCTGGGGGAGCGCGATCCGCTGCCCACGGACGTTG
AACTGGCTGGAGCGGGCATGTCGACTGATAACT

BS16669.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:04:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG10130-PA 303 Sec61beta-RA 1..303 319..17 1490 99.6 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 22:11:53
Subject Length Description Subject Range Query Range Score Percent Strand
Sec61beta-RA 792 CG10130-RA 130..432 319..17 1500 99.7 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 22:11:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14618958..14619170 317..105 1065 100 Minus
2R 25286936 2R 14619234..14619321 104..17 425 98.9 Minus
Blast to na_te.dros performed on 2015-02-11 22:11:52 has no hits.

BS16669.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:04:35 Download gff for BS16669.3prime
Subject Subject Range Query Range Percent Splice Strand
CG10130-PA 1..303 17..319 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 02:30:00 Download gff for BS16669.3prime
Subject Subject Range Query Range Percent Splice Strand
Sec61beta-RA 130..434 13..319 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 00:54:30 Download gff for BS16669.3prime
Subject Subject Range Query Range Percent Splice Strand
Sec61beta-RA 130..434 13..319 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 00:54:30 Download gff for BS16669.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 14618949..14619170 105..327 98 -> Minus
2R 14619234..14619323 13..104 96   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 02:30:00 Download gff for BS16669.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10506454..10506675 105..327 98 -> Minus
arm_2R 10506739..10506828 13..104 96   Minus

BS16669.5prime Sequence

333 bp (333 high quality bases) assembled on 2007-05-15

> BS16669.5prime
GAAGTTATCAGTCGACATGCCCGCTCCAGCCAGTTCAACGTCCGTGGGCA
GCGGATCGCGCTCCCCCAGCAAATTGTCGGCGCCACGTAGCGCCGGATCC
GGAGGCGGCAGCACCCTGAAGCAGCGCAAGACCACCACCAGCACCACAGC
GGCCCGGAGCCGTGCACCCGGCGGAGCCGGAACTGGTGGCATGTGGCGTT
TCTACACGGACGACTCGCCCGGTATCAAAGTTGGTCCCGTACCCGTGCTG
GTCATGTCGCTGCTGTTCATCGCTTCCGTCTTCATGCTGCACATTTGGGG
CAAATACAATCGTTCTTAAAAGCTTTCTAGACC

BS16669.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:00:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG10130-PA 303 Sec61beta-RA 1..303 17..319 1490 99.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 13:16:31
Subject Length Description Subject Range Query Range Score Percent Strand
Sec61beta-RA 792 CG10130-RA 130..432 17..319 1500 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 13:16:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14618958..14619170 19..231 1065 100 Plus
2R 25286936 2R 14619234..14619321 232..319 425 98.9 Plus
Blast to na_te.dros performed on 2015-02-13 13:16:29 has no hits.

BS16669.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:00:14 Download gff for BS16669.5prime
Subject Subject Range Query Range Percent Splice Strand
CG10130-PA 1..303 17..319 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 17:40:43 Download gff for BS16669.5prime
Subject Subject Range Query Range Percent Splice Strand
Sec61beta-RA 130..434 17..323 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 15:52:08 Download gff for BS16669.5prime
Subject Subject Range Query Range Percent Splice Strand
Sec61beta-RA 130..434 17..323 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 15:52:08 Download gff for BS16669.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 14618949..14619170 9..231 98 -> Plus
2R 14619234..14619323 232..323 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 17:40:43 Download gff for BS16669.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10506454..10506675 9..231 98 -> Plus
arm_2R 10506739..10506828 232..323 96   Plus

BS16669.complete Sequence

335 bp assembled on 2007-05-07

GenBank Submission: FJ638176

> BS16669.complete
GAAGTTATCAGTCGACATGCCCGCTCCAGCCAGTTCAACGTCCGTGGGCA
GCGGATCGCGCTCCCCCAGCAAATTGTCGGCGCCACGTAGCGCCGGATCC
GGAGGCGGCAGCACCCTGAAGCAGCGCAAGACCACCACCAGCACCACAGC
GGCCCGGAGCCGTGCACCCGGCGGAGCCGGAACTGGTGGCATGTGGCGTT
TCTACACGGACGACTCGCCCGGTATCAAAGTTGGTCCCGTACCCGTGCTG
GTCATGTCGCTGCTGTTCATCGCTTCCGTCTTCATGCTGCACATTTGGGG
CAAATACAATCGTTCTTAAAAGCTTTCTAGACCAT

BS16669.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:34:52
Subject Length Description Subject Range Query Range Score Percent Strand
Sec61beta-RA 303 CG10130-PA 1..303 17..319 1500 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:34:53
Subject Length Description Subject Range Query Range Score Percent Strand
Sec61beta-RA 792 CG10130-RA 130..432 17..319 1500 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:34:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14618958..14619170 19..231 1065 100 Plus
2R 25286936 2R 14619234..14619321 232..319 425 98.9 Plus
Blast to na_te.dros performed on 2014-11-27 20:34:50 has no hits.

BS16669.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:46:28 Download gff for BS16669.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61beta-RA 1..303 17..319 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:34:09 Download gff for BS16669.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61beta-RA 174..478 17..323 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:11:46 Download gff for BS16669.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61beta-RA 130..430 17..317 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:46:28 Download gff for BS16669.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61beta-RA 174..478 17..323 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:24:12 Download gff for BS16669.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61beta-RA 130..430 17..317 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:24:12 Download gff for BS16669.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14618957..14619170 17..231 99 -> Plus
2R 14619234..14619319 232..317 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:11:46 Download gff for BS16669.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10506462..10506675 17..231 99 -> Plus
arm_2R 10506739..10506824 232..317 98   Plus

BS16669.pep Sequence

Translation from 16 to 318

> BS16669.pep
MPAPASSTSVGSGSRSPSKLSAPRSAGSGGGSTLKQRKTTTSTTAARSRA
PGGAGTGGMWRFYTDDSPGIKVGPVPVLVMSLLFIASVFMLHIWGKYNRS
*

BS16669.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:48:46
Subject Length Description Subject Range Query Range Score Percent Strand
Sec61beta-PA 100 CG10130-PA 1..100 1..100 514 100 Plus