Clone Sequence Records
BS16673.3prime Sequence
288 bp (288 high quality bases) assembled on 2007-05-15
> BS16673.3prime
ATGGTCTAGAAAGCTTCTATTGCCGCAGAAGATGAGCCACAATCACCGAG
AGCAGTGTGCCAGTTAGGACGCCCATCAGTCCTAGCCTATGGATGCCCGC
CGAGTTGCAGCCGTCCTTGCTGTTGCACGTGCAGAACTCCATGAAGATGT
TGTAGCTGCCAGTGCGCATCAGGCAGAAGCGTTCGTCGCCCTCGATGCCC
GGCTCGCCCATGTAGGCGCAGCTGCGAAAGTAGCGCCATTCACCGTGCAC
CTTCTGCCGGATCTTGCGACACATGTCGACTGATAACT
BS16673.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:04:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17218-PA | 456 | CG17218-RA | 199..456 | 274..17 | 1290 | 100 | Minus |
CG17218-PB | 258 | CG17218-RB | 1..258 | 274..17 | 1290 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 15:47:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
crok-RA | 1033 | CG17218-RA | 288..545 | 274..17 | 1290 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 15:47:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 12173346..12173603 | 274..17 | 1290 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-11 15:47:18 has no hits.
BS16673.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:04:39 Download gff for
BS16673.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17218-PB | 1..258 | 17..274 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 19:48:58 Download gff for
BS16673.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
crok-RA | 283..545 | 17..278 | 99 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:24:19 Download gff for
BS16673.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
crok-RA | 283..545 | 17..278 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:24:19 Download gff for
BS16673.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 12173341..12173603 | 17..278 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 19:48:58 Download gff for
BS16673.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 12173341..12173603 | 17..278 | 99 | | Minus |
BS16673.5prime Sequence
288 bp (288 high quality bases) assembled on 2007-05-15
> BS16673.5prime
GAAGTTATCAGTCGACATGTGTCGCAAGATCCGGCAGAAGGTGCACGGTG
AATGGCGCTACTTTCGCAGCTGCGCCTACATGGGCGAGCCGGGCATCGAG
GGCGACGAACGCTTCTGCCTGATGCGCACTGGCAGCTACAACATCTTCAT
GGAGTTCTGCACGTGCAACAGCAAGGACGGCTGCAACTCGGCGGGCATCC
ATAGGCTAGGACTGATGGGCGTCCTAACTGGCACACTGCTCTCGGTGATT
GTGGCTCATCTTCTGCGGCAATAGAAGCTTTCTAGACC
BS16673.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:00:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17218-PA | 456 | CG17218-RA | 199..456 | 17..274 | 1290 | 100 | Plus |
CG17218-PB | 258 | CG17218-RB | 1..258 | 17..274 | 1290 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 15:42:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
crok-RA | 1033 | CG17218-RA | 288..545 | 17..274 | 1290 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 15:42:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 12173346..12173603 | 17..274 | 1290 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-11 15:42:47 has no hits.
BS16673.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:00:20 Download gff for
BS16673.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17218-PB | 1..258 | 17..274 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 19:48:17 Download gff for
BS16673.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
crok-RA | 283..545 | 13..274 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:14:51 Download gff for
BS16673.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
crok-RA | 283..545 | 13..274 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:14:51 Download gff for
BS16673.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 12173341..12173603 | 13..274 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 19:48:17 Download gff for
BS16673.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 12173341..12173603 | 13..274 | 99 | | Plus |
BS16673.complete Sequence
290 bp assembled on 2007-05-07
GenBank Submission: FJ638177
> BS16673.complete
GAAGTTATCAGTCGACATGTGTCGCAAGATCCGGCAGAAGGTGCACGGTG
AATGGCGCTACTTTCGCAGCTGCGCCTACATGGGCGAGCCGGGCATCGAG
GGCGACGAACGCTTCTGCCTGATGCGCACTGGCAGCTACAACATCTTCAT
GGAGTTCTGCACGTGCAACAGCAAGGACGGCTGCAACTCGGCGGGCATCC
ATAGGCTAGGACTGATGGGCGTCCTAACTGGCACACTGCTCTCGGTGATT
GTGGCTCATCTTCTGCGGCAATAGAAGCTTTCTAGACCAT
BS16673.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:28:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
crok-RA | 456 | CG17218-PA | 199..456 | 17..274 | 1290 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:28:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
crok-RA | 1033 | CG17218-RA | 288..545 | 17..274 | 1290 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:28:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 12173346..12173603 | 17..274 | 1290 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 00:28:50 has no hits.
BS16673.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:30:21 Download gff for
BS16673.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17218-RA | 194..456 | 13..274 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:02:29 Download gff for
BS16673.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17218-RA | 280..542 | 13..274 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:53:04 Download gff for
BS16673.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
crok-RA | 288..545 | 17..274 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:30:21 Download gff for
BS16673.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17218-RA | 280..542 | 13..274 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:21:14 Download gff for
BS16673.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
crok-RA | 288..545 | 17..274 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:21:14 Download gff for
BS16673.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 12173346..12173603 | 17..274 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:53:04 Download gff for
BS16673.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 12173346..12173603 | 17..274 | 100 | | Plus |
BS16673.pep Sequence
Translation from 16 to 273
> BS16673.pep
MCRKIRQKVHGEWRYFRSCAYMGEPGIEGDERFCLMRTGSYNIFMEFCTC
NSKDGCNSAGIHRLGLMGVLTGTLLSVIVAHLLRQ*
BS16673.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:26:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
crok-PA | 151 | CG17218-PA | 67..151 | 1..85 | 466 | 100 | Plus |