Clone BS16673 Report

Search the DGRC for BS16673

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:166
Well:73
Vector:pDNR-Dual
Associated Gene/Transcriptcrok-RB
Protein status:BS16673.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS16673.3prime Sequence

288 bp (288 high quality bases) assembled on 2007-05-15

> BS16673.3prime
ATGGTCTAGAAAGCTTCTATTGCCGCAGAAGATGAGCCACAATCACCGAG
AGCAGTGTGCCAGTTAGGACGCCCATCAGTCCTAGCCTATGGATGCCCGC
CGAGTTGCAGCCGTCCTTGCTGTTGCACGTGCAGAACTCCATGAAGATGT
TGTAGCTGCCAGTGCGCATCAGGCAGAAGCGTTCGTCGCCCTCGATGCCC
GGCTCGCCCATGTAGGCGCAGCTGCGAAAGTAGCGCCATTCACCGTGCAC
CTTCTGCCGGATCTTGCGACACATGTCGACTGATAACT

BS16673.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:04:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG17218-PA 456 CG17218-RA 199..456 274..17 1290 100 Minus
CG17218-PB 258 CG17218-RB 1..258 274..17 1290 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 15:47:19
Subject Length Description Subject Range Query Range Score Percent Strand
crok-RA 1033 CG17218-RA 288..545 274..17 1290 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 15:47:16
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12173346..12173603 274..17 1290 100 Minus
Blast to na_te.dros performed on 2015-02-11 15:47:18 has no hits.

BS16673.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:04:39 Download gff for BS16673.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17218-PB 1..258 17..274 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 19:48:58 Download gff for BS16673.3prime
Subject Subject Range Query Range Percent Splice Strand
crok-RA 283..545 17..278 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:24:19 Download gff for BS16673.3prime
Subject Subject Range Query Range Percent Splice Strand
crok-RA 283..545 17..278 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:24:19 Download gff for BS16673.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 12173341..12173603 17..278 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 19:48:58 Download gff for BS16673.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 12173341..12173603 17..278 99   Minus

BS16673.5prime Sequence

288 bp (288 high quality bases) assembled on 2007-05-15

> BS16673.5prime
GAAGTTATCAGTCGACATGTGTCGCAAGATCCGGCAGAAGGTGCACGGTG
AATGGCGCTACTTTCGCAGCTGCGCCTACATGGGCGAGCCGGGCATCGAG
GGCGACGAACGCTTCTGCCTGATGCGCACTGGCAGCTACAACATCTTCAT
GGAGTTCTGCACGTGCAACAGCAAGGACGGCTGCAACTCGGCGGGCATCC
ATAGGCTAGGACTGATGGGCGTCCTAACTGGCACACTGCTCTCGGTGATT
GTGGCTCATCTTCTGCGGCAATAGAAGCTTTCTAGACC

BS16673.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:00:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG17218-PA 456 CG17218-RA 199..456 17..274 1290 100 Plus
CG17218-PB 258 CG17218-RB 1..258 17..274 1290 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 15:42:49
Subject Length Description Subject Range Query Range Score Percent Strand
crok-RA 1033 CG17218-RA 288..545 17..274 1290 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 15:42:46
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12173346..12173603 17..274 1290 100 Plus
Blast to na_te.dros performed on 2015-02-11 15:42:47 has no hits.

BS16673.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:00:20 Download gff for BS16673.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17218-PB 1..258 17..274 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 19:48:17 Download gff for BS16673.5prime
Subject Subject Range Query Range Percent Splice Strand
crok-RA 283..545 13..274 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:14:51 Download gff for BS16673.5prime
Subject Subject Range Query Range Percent Splice Strand
crok-RA 283..545 13..274 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:14:51 Download gff for BS16673.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 12173341..12173603 13..274 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 19:48:17 Download gff for BS16673.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 12173341..12173603 13..274 99   Plus

BS16673.complete Sequence

290 bp assembled on 2007-05-07

GenBank Submission: FJ638177

> BS16673.complete
GAAGTTATCAGTCGACATGTGTCGCAAGATCCGGCAGAAGGTGCACGGTG
AATGGCGCTACTTTCGCAGCTGCGCCTACATGGGCGAGCCGGGCATCGAG
GGCGACGAACGCTTCTGCCTGATGCGCACTGGCAGCTACAACATCTTCAT
GGAGTTCTGCACGTGCAACAGCAAGGACGGCTGCAACTCGGCGGGCATCC
ATAGGCTAGGACTGATGGGCGTCCTAACTGGCACACTGCTCTCGGTGATT
GTGGCTCATCTTCTGCGGCAATAGAAGCTTTCTAGACCAT

BS16673.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:28:51
Subject Length Description Subject Range Query Range Score Percent Strand
crok-RA 456 CG17218-PA 199..456 17..274 1290 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:28:53
Subject Length Description Subject Range Query Range Score Percent Strand
crok-RA 1033 CG17218-RA 288..545 17..274 1290 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:28:49
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12173346..12173603 17..274 1290 100 Plus
Blast to na_te.dros performed on 2014-11-28 00:28:50 has no hits.

BS16673.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:30:21 Download gff for BS16673.complete
Subject Subject Range Query Range Percent Splice Strand
CG17218-RA 194..456 13..274 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:02:29 Download gff for BS16673.complete
Subject Subject Range Query Range Percent Splice Strand
CG17218-RA 280..542 13..274 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:53:04 Download gff for BS16673.complete
Subject Subject Range Query Range Percent Splice Strand
crok-RA 288..545 17..274 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:30:21 Download gff for BS16673.complete
Subject Subject Range Query Range Percent Splice Strand
CG17218-RA 280..542 13..274 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:21:14 Download gff for BS16673.complete
Subject Subject Range Query Range Percent Splice Strand
crok-RA 288..545 17..274 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:21:14 Download gff for BS16673.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12173346..12173603 17..274 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:53:04 Download gff for BS16673.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 12173346..12173603 17..274 100   Plus

BS16673.pep Sequence

Translation from 16 to 273

> BS16673.pep
MCRKIRQKVHGEWRYFRSCAYMGEPGIEGDERFCLMRTGSYNIFMEFCTC
NSKDGCNSAGIHRLGLMGVLTGTLLSVIVAHLLRQ*

BS16673.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:26:27
Subject Length Description Subject Range Query Range Score Percent Strand
crok-PA 151 CG17218-PA 67..151 1..85 466 100 Plus