Clone BS16811 Report

Search the DGRC for BS16811

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:168
Well:11
Vector:pDNR-Dual
Associated Gene/TranscriptCG33472-RA
Protein status:BS16811.pep: validated full length
Sequenced Size:16

Clone Sequence Records

BS16811.3prime Sequence

411 bp (411 high quality bases) assembled on 2007-05-15

> BS16811.3prime
ATGGTCTAGAAAGCTTTTAGCCAAGATACTGCCACTGCGATGGGTATGAG
ATGCAGCTGGCAACCATTAGTGTGTAAATTTTTACTAGAATTGCACATAT
CTTCCTCACAAAAGCACATACGTCCACTGCCTGAACCTTCCACCATGCAC
ACGTGATCGACCATGAATAAATTGATCTGTAACTGTGACGTACACATGCG
TCGCACCACCTTGGCAGGGCTGTATAGTTGAAAGGATCCTTGCAGCGGGC
ATCAGTCCAGGAGTCGCACTCATAGCAGTAAATCGATCGCGTTTGACATT
CGGCTGAGGTCTGCGGAATCCATATGAAAGTTAGAAATCCGATAACGGCT
GTTAATACCAACAGCCAATTGCCAACTGCATTTCTCTGCGTCCACATGTC
GACTGATAACT

BS16811.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:26:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG33472-PA 255 CG33472-RA 1..254 397..144 1270 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 05:59:20
Subject Length Description Subject Range Query Range Score Percent Strand
qvr-RB 5055 CG33472-RB 725..913 397..209 945 100 Minus
qvr-RB 5055 CG33472-RB 984..1178 211..17 915 97.9 Minus
qvr-RC 5046 CG33472-RC 975..1169 211..17 915 97.9 Minus
qvr-RC 5046 CG33472-RC 725..904 397..209 455 84.1 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 05:59:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11447533..11447727 211..17 915 97.9 Minus
2R 25286936 2R 11446130..11446189 351..292 300 100 Minus
2R 25286936 2R 11447156..11447209 291..238 270 100 Minus
2R 25286936 2R 11444712..11444760 397..349 245 100 Minus
Blast to na_te.dros performed on 2015-02-13 05:59:19 has no hits.

BS16811.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:26:56 Download gff for BS16811.3prime
Subject Subject Range Query Range Percent Splice Strand
CG33472-PA 1..255 143..397 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 18:47:47 Download gff for BS16811.3prime
Subject Subject Range Query Range Percent Splice Strand
qvr-RB 986..1178 17..209 97   Minus
qvr-RB 725..912 210..397 100 -> Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 08:06:23 Download gff for BS16811.3prime
Subject Subject Range Query Range Percent Splice Strand
qvr-RB 725..912 210..397 100 -> Minus
qvr-RB 986..1178 17..209 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 08:06:23 Download gff for BS16811.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 11444712..11444760 349..397 100 -> Minus
2R 11446133..11446189 292..348 100 -> Minus
2R 11447156..11447208 239..291 100 -> Minus
2R 11447270..11447298 210..238 100 -> Minus
2R 11447535..11447727 17..209 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 18:47:47 Download gff for BS16811.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7332217..7332265 349..397 100 -> Minus
arm_2R 7333638..7333694 292..348 100 -> Minus
arm_2R 7334661..7334713 239..291 100 -> Minus
arm_2R 7334775..7334803 210..238 100 -> Minus
arm_2R 7335040..7335232 17..209 97   Minus

BS16811.5prime Sequence

411 bp (411 high quality bases) assembled on 2007-05-15

> BS16811.5prime
GAAGTTATCAGTCGACATGTGGACGCAGAGAAATGCAGTTGGCAATTGGC
TGTTGGTATTAACAGCCGTTATCGGATTTCTAACTTTCATATGGATTCCG
CAGACCTCAGCCGAATGTCAAACGCGATCGATTTACTGCTATGAGTGCGA
CTCCTGGACTGATGCCCGCTGCAAGGATCCTTTCAACTATACAGCCCTGC
CAAGGTGGTGCGACGCATGTGTACGTCACAGTTACAGATCAATTTATTCA
TGGTCGATCACGTGTGCATGGTGGAAGGTTCAGGCAGTGGACGTATGTGC
TTTTGTGAGGAAGATATGTGCAATTCTAGTAAAAATTTACACACTAATGG
TTGCCAGCTGCATCTCATACCCATCGCAGTGGCAGTATCTTGGCTAAAAG
CTTTCTAGACC

BS16811.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:21:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG33472-PA 255 CG33472-RA 1..254 17..270 1270 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 03:42:16
Subject Length Description Subject Range Query Range Score Percent Strand
qvr-RB 5055 CG33472-RB 725..913 17..205 945 100 Plus
qvr-RB 5055 CG33472-RB 984..1178 203..397 915 97.9 Plus
qvr-RC 5046 CG33472-RC 975..1169 203..397 915 97.9 Plus
qvr-RC 5046 CG33472-RC 725..904 17..205 455 84.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 03:42:10
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11447533..11447727 203..397 915 97.9 Plus
2R 25286936 2R 11446130..11446189 63..122 300 100 Plus
2R 25286936 2R 11447156..11447209 123..176 270 100 Plus
2R 25286936 2R 11444712..11444760 17..65 245 100 Plus
Blast to na_te.dros performed on 2015-02-11 03:42:13 has no hits.

BS16811.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:21:03 Download gff for BS16811.5prime
Subject Subject Range Query Range Percent Splice Strand
CG33472-PA 1..255 17..271 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 06:26:05 Download gff for BS16811.5prime
Subject Subject Range Query Range Percent Splice Strand
qvr-RB 725..912 17..204 100 -> Plus
qvr-RB 986..1178 205..397 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 05:28:45 Download gff for BS16811.5prime
Subject Subject Range Query Range Percent Splice Strand
qvr-RB 986..1178 205..397 97   Plus
qvr-RB 725..912 17..204 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 05:28:45 Download gff for BS16811.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 11444712..11444760 17..65 100 -> Plus
2R 11446133..11446189 66..122 100 -> Plus
2R 11447156..11447208 123..175 100 -> Plus
2R 11447270..11447298 176..204 100 -> Plus
2R 11447535..11447727 205..397 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 06:26:05 Download gff for BS16811.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7332217..7332265 17..65 100 -> Plus
arm_2R 7333638..7333694 66..122 100 -> Plus
arm_2R 7334661..7334713 123..175 100 -> Plus
arm_2R 7334775..7334803 176..204 100 -> Plus
arm_2R 7335040..7335232 205..397 97   Plus

BS16811.complete Sequence

413 bp assembled on 2007-05-07

GenBank Submission: FJ638196

> BS16811.complete
GAAGTTATCAGTCGACATGTGGACGCAGAGAAATGCAGTTGGCAATTGGC
TGTTGGTATTAACAGCCGTTATCGGATTTCTAACTTTCATATGGATTCCG
CAGACCTCAGCCGAATGTCAAACGCGATCGATTTACTGCTATGAGTGCGA
CTCCTGGACTGATGCCCGCTGCAAGGATCCTTTCAACTATACAGCCCTGC
CAAGGTGGTGCGACGCATGTGTACGTCACAGTTACAGATCAATTTATTCA
TGGTCGATCACGTGTGCATGGTGGAAGGTTCAGGCAGTGGACGTATGTGC
TTTTGTGAGGAAGATATGTGCAATTCTAGTAAAAATTTACACACTAATGG
TTGCCAGCTGCATCTCATACCCATCGCAGTGGCAGTATCTTGGCTAAAAG
CTTTCTAGACCAT

BS16811.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:55:24
Subject Length Description Subject Range Query Range Score Percent Strand
qvr-RB 477 CG33472-PB 1..189 17..205 945 100 Plus
qvr-RB 477 CG33472-PB 260..454 203..397 915 97.9 Plus
qvr-RC 468 CG33472-PC 251..445 203..397 915 97.9 Plus
qvr-RC 468 CG33472-PC 96..180 121..205 425 100 Plus
qvr-RC 468 CG33472-PC 1..49 17..65 245 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:55:25
Subject Length Description Subject Range Query Range Score Percent Strand
qvr-RB 5055 CG33472-RB 725..913 17..205 945 100 Plus
qvr-RB 5055 CG33472-RB 984..1178 203..397 915 97.9 Plus
qvr-RC 5046 CG33472-RC 975..1169 203..397 915 97.9 Plus
qvr-RC 5046 CG33472-RC 820..904 121..205 425 100 Plus
qvr-RC 5046 CG33472-RC 725..773 17..65 245 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 12:55:22
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11447533..11447727 203..397 915 97.9 Plus
2R 25286936 2R 11446130..11446189 63..122 300 100 Plus
2R 25286936 2R 11447156..11447209 123..176 270 100 Plus
2R 25286936 2R 11444712..11444760 17..65 245 100 Plus
Blast to na_te.dros performed on 2014-11-27 12:55:23 has no hits.

BS16811.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:30:02 Download gff for BS16811.complete
Subject Subject Range Query Range Percent Splice Strand
CG33472-RA 1..255 17..271 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:02:07 Download gff for BS16811.complete
Subject Subject Range Query Range Percent Splice Strand
CG33472-RA 704..1084 17..397 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:38:47 Download gff for BS16811.complete
Subject Subject Range Query Range Percent Splice Strand
qvr-RB 725..912 17..204 100 -> Plus
qvr-RB 986..1176 205..395 97   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:30:02 Download gff for BS16811.complete
Subject Subject Range Query Range Percent Splice Strand
CG33472-RA 704..1084 17..397 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:07:24 Download gff for BS16811.complete
Subject Subject Range Query Range Percent Splice Strand
qvr-RB 986..1176 205..395 97   Plus
qvr-RB 725..912 17..204 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:07:24 Download gff for BS16811.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11444712..11444760 17..65 100 -> Plus
2R 11446133..11446189 66..122 100 -> Plus
2R 11447156..11447208 123..175 100 -> Plus
2R 11447270..11447298 176..204 100 -> Plus
2R 11447535..11447725 205..395 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:38:47 Download gff for BS16811.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7332217..7332265 17..65 100 -> Plus
arm_2R 7333638..7333694 66..122 100 -> Plus
arm_2R 7334661..7334713 123..175 100 -> Plus
arm_2R 7334775..7334803 176..204 100 -> Plus
arm_2R 7335040..7335230 205..395 97   Plus

BS16811.pep Sequence

Translation from 16 to 396

> BS16811.pep
MWTQRNAVGNWLLVLTAVIGFLTFIWIPQTSAECQTRSIYCYECDSWTDA
RCKDPFNYTALPRWCDACVRHSYRSIYSWSITCAWWKVQAVDVCAFVRKI
CAILVKIYTLMVASCISYPSQWQYLG*

BS16811.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:26:58
Subject Length Description Subject Range Query Range Score Percent Strand
qvr-PB 158 CG33472-PB 1..86 1..77 361 81.6 Plus
qvr-PC 155 CG33472-PC 1..83 1..77 248 62.5 Plus