Clone BS16981 Report

Search the DGRC for BS16981

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:169
Well:81
Vector:pDNR-Dual
Associated Gene/TranscriptCG32266-RA
Protein status:BS16981.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS16981.3prime Sequence

264 bp (264 high quality bases) assembled on 2007-05-15

> BS16981.3prime
ATGGTCTAGAAAGCTTTCACCGTCTCAGGTACAGCGAGCTGTAGGGATAG
GCTCCGTAGGCGTAGGGCGTGGCGGCATAGACGCCGCTGGTGTAGGCAGC
ACTGTACGTGGGTGCGTAGAGTCCGCCCGAGTAGGCGTAGGGCGTGGCAG
CAACCACAGGCGAGGCCGCACTGTAGGCGGTCAGGAATTGCGGCTTGCCA
CAGGCAACGGCCAACAGGGCGAACAGGCACAGAGCGAAAAACTTGAACAT
GTCGACTGATAACT

BS16981.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:38:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG32266-PA 234 CG32266-RA 1..230 250..21 1150 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:00:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG32266-RA 526 CG32266-RA 41..275 250..16 1160 99.6 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:00:30
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3791087..3791309 238..16 1100 99.6 Minus
Blast to na_te.dros performed on 2015-02-12 11:00:32 has no hits.

BS16981.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:39:01 Download gff for BS16981.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32266-PA 1..234 17..250 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 20:52:35 Download gff for BS16981.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32266-RA 30..278 11..260 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:39:17 Download gff for BS16981.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32266-RA 30..278 11..260 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:39:17 Download gff for BS16981.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 3791087..3791309 16..238 99 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 20:52:35 Download gff for BS16981.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3791087..3791309 16..238 99 -> Minus

BS16981.5prime Sequence

264 bp (264 high quality bases) assembled on 2007-05-15

> BS16981.5prime
GAAGTTATCAGTCGACATGTTCAAGTTTTTCGCTCTGTGCCTGTTCGCCC
TGTTGGCCGTTGCCTGTGGCAAGCCGCAATTCCTGACCGCCTACAGTGCG
GCCTCGCCTGTGGTTGCTGCCACGCCCTACGCCTACTCGGGCGGACTCTA
CGCACCCACGTACAGTGCTGCCTACACCAGCGGCGTCTATGCCGCCACGC
CCTACGCCTACGGAGCCTATCCCTACAGCTCGCTGTACCTGAGACGCTGA
AAGCTTTCTAGACC

BS16981.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:32:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG32266-PA 234 CG32266-RA 1..234 17..250 1170 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 15:57:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG32266-RA 526 CG32266-RA 41..275 17..251 1175 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 15:57:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3791087..3791309 29..251 1115 100 Plus
Blast to na_te.dros performed on 2015-02-10 15:57:08 has no hits.

BS16981.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:32:39 Download gff for BS16981.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32266-PA 1..234 17..250 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 02:35:04 Download gff for BS16981.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32266-RA 30..286 7..264 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:26:18 Download gff for BS16981.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32266-RA 30..286 7..264 96   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:26:18 Download gff for BS16981.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 3791087..3791320 29..264 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 02:35:04 Download gff for BS16981.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3791087..3791320 29..264 97   Plus

BS16981.complete Sequence

266 bp assembled on 2007-05-07

GenBank Submission: FJ638226

> BS16981.complete
GAAGTTATCAGTCGACATGTTCAAGTTTTTCGCTCTGTGCCTGTTCGCCC
TGTTGGCCGTTGCCTGTGGCAAGCCGCAATTCCTGACCGCCTACAGTGCG
GCCTCGCCTGTGGTTGCTGCCACGCCCTACGCCTACTCGGGCGGACTCTA
CGCACCCACGTACAGTGCTGCCTACACCAGCGGCGTCTATGCCGCCACGC
CCTACGCCTACGGAGCCTATCCCTACAGCTCGCTGTACCTGAGACGCTGA
AAGCTTTCTAGACCAT

BS16981.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:43:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG32266-RA 234 CG32266-PA 1..234 17..250 1170 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:43:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG32266-RA 526 CG32266-RA 41..275 17..251 1175 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:43:32
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3791087..3791309 29..251 1115 100 Plus
Blast to na_te.dros performed on 2014-11-27 16:43:33 has no hits.

BS16981.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:12:52 Download gff for BS16981.complete
Subject Subject Range Query Range Percent Splice Strand
CG32266-RA 1..234 17..250 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:14:16 Download gff for BS16981.complete
Subject Subject Range Query Range Percent Splice Strand
CG32266-RA 30..288 7..266 96   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:58:31 Download gff for BS16981.complete
Subject Subject Range Query Range Percent Splice Strand
CG32266-RA 46..273 22..249 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:12:52 Download gff for BS16981.complete
Subject Subject Range Query Range Percent Splice Strand
CG32266-RA 30..288 7..266 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:25:25 Download gff for BS16981.complete
Subject Subject Range Query Range Percent Splice Strand
CG32266-RA 46..273 22..249 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:25:25 Download gff for BS16981.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3791083..3791307 22..249 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:58:31 Download gff for BS16981.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3791083..3791307 22..249 98   Plus

BS16981.pep Sequence

Translation from 16 to 249

> BS16981.pep
MFKFFALCLFALLAVACGKPQFLTAYSAASPVVAATPYAYSGGLYAPTYS
AAYTSGVYAATPYAYGAYPYSSLYLRR*

BS16981.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:37:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG32266-PA 77 CG32266-PA 1..77 1..77 403 100 Plus
CG13067-PA 79 CG13067-PA 1..78 1..74 150 50 Plus
CG13069-PA 97 CG13069-PA 1..79 1..70 135 40.5 Plus