Clone BS17041 Report

Search the DGRC for BS17041

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:170
Well:41
Vector:pDNR-Dual
Associated Gene/TranscriptDef-RA
Protein status:BS17041.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS17041.3prime Sequence

309 bp (309 high quality bases) assembled on 2007-05-15

> BS17041.3prime
ATGGTCTAGAAAGCTTTCAATTGCGGCAAACGCAGACGGCCTTGTCGTTG
CAGTAGCCGCCTTTGAACCCCTTGGCAATGCAGTGGCCGGCGCAGGCGGT
GTGGTTCCAGTTCCACTTGGAGAGTAGGTCGCATGTGGCTCGCTTCTGGC
GGCTATGCTGCAGCACCTCCTGGTGGGCATCCTCATGCACCAGGACATGA
TCCTCTGGAATTGGATCCACATCGGAAACTGGCTGAGCCTGCGCCACGCA
AGCAAGCAGAGCAAAAGCGATAGCCACGAGAACGAAGAACTTCATGTCGA
CTGATAACT

BS17041.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:59:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG1385-PA 279 Def-RA 1..279 295..17 1395 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 15:14:21
Subject Length Description Subject Range Query Range Score Percent Strand
Def-RA 399 CG1385-RA 10..288 295..17 1395 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 15:14:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10054289..10054567 17..295 1395 100 Plus
Blast to na_te.dros performed on 2015-02-13 15:14:19 has no hits.

BS17041.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:59:25 Download gff for BS17041.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1385-PA 1..279 17..295 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 11:50:20 Download gff for BS17041.3prime
Subject Subject Range Query Range Percent Splice Strand
Def-RA 10..292 9..295 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:55:01 Download gff for BS17041.3prime
Subject Subject Range Query Range Percent Splice Strand
Def-RA 10..292 9..295 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 16:55:01 Download gff for BS17041.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 10054280..10054567 9..295 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 11:50:20 Download gff for BS17041.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5941785..5942072 9..295 98   Plus

BS17041.5prime Sequence

309 bp (309 high quality bases) assembled on 2007-05-15

> BS17041.5prime
GAAGTTATCAGTCGACATGAAGTTCTTCGTTCTCGTGGCTATCGCTTTTG
CTCTGCTTGCTTGCGTGGCGCAGGCTCAGCCAGTTTCCGATGTGGATCCA
ATTCCAGAGGATCATGTCCTGGTGCATGAGGATGCCCACCAGGAGGTGCT
GCAGCATAGCCGCCAGAAGCGAGCCACATGCGACCTACTCTCCAAGTGGA
ACTGGAACCACACCGCCTGCGCCGGCCACTGCATTGCCAAGGGGTTCAAA
GGCGGCTACTGCAACGACAAGGCCGTCTGCGTTTGCCGCAATTGAAAGCT
TTCTAGACC

BS17041.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:55:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG1385-PA 279 Def-RA 1..279 17..295 1395 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 23:40:28
Subject Length Description Subject Range Query Range Score Percent Strand
Def-RA 399 CG1385-RA 10..288 17..295 1395 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 23:40:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10054289..10054567 295..17 1395 100 Minus
Blast to na_te.dros performed on 2015-02-12 23:40:27 has no hits.

BS17041.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:55:32 Download gff for BS17041.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1385-PA 1..279 17..295 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 21:49:44 Download gff for BS17041.5prime
Subject Subject Range Query Range Percent Splice Strand
Def-RA 10..292 17..303 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 02:14:07 Download gff for BS17041.5prime
Subject Subject Range Query Range Percent Splice Strand
Def-RA 10..292 17..303 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 02:14:07 Download gff for BS17041.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 10054280..10054567 17..303 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 21:49:44 Download gff for BS17041.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5941785..5942072 17..303 98   Minus

BS17041.complete Sequence

311 bp assembled on 2007-05-08

GenBank Submission: FJ638229

> BS17041.complete
GAAGTTATCAGTCGACATGAAGTTCTTCGTTCTCGTGGCTATCGCTTTTG
CTCTGCTTGCTTGCGTGGCGCAGGCTCAGCCAGTTTCCGATGTGGATCCA
ATTCCAGAGGATCATGTCCTGGTGCATGAGGATGCCCACCAGGAGGTGCT
GCAGCATAGCCGCCAGAAGCGAGCCACATGCGACCTACTCTCCAAGTGGA
ACTGGAACCACACCGCCTGCGCCGGCCACTGCATTGCCAAGGGGTTCAAA
GGCGGCTACTGCAACGACAAGGCCGTCTGCGTTTGCCGCAATTGAAAGCT
TTCTAGACCAT

BS17041.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 19:55:32
Subject Length Description Subject Range Query Range Score Percent Strand
Def-RA 279 CG1385-PA 1..279 17..295 1395 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 19:55:33
Subject Length Description Subject Range Query Range Score Percent Strand
Def-RA 399 CG1385-RA 10..288 17..295 1395 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 19:55:30
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10054289..10054567 295..17 1395 100 Minus
Blast to na_te.dros performed on 2014-11-27 19:55:31 has no hits.

BS17041.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:40:47 Download gff for BS17041.complete
Subject Subject Range Query Range Percent Splice Strand
Def-RA 1..279 17..295 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:16:48 Download gff for BS17041.complete
Subject Subject Range Query Range Percent Splice Strand
Def-RA 1..279 17..295 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:00:54 Download gff for BS17041.complete
Subject Subject Range Query Range Percent Splice Strand
Def-RA 10..287 17..294 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:40:47 Download gff for BS17041.complete
Subject Subject Range Query Range Percent Splice Strand
Def-RA 1..279 17..295 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:10:54 Download gff for BS17041.complete
Subject Subject Range Query Range Percent Splice Strand
Def-RA 10..287 17..294 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:10:54 Download gff for BS17041.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10054290..10054567 17..294 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:00:54 Download gff for BS17041.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5941795..5942072 17..294 100   Minus

BS17041.pep Sequence

Translation from 16 to 294

> BS17041.pep
MKFFVLVAIAFALLACVAQAQPVSDVDPIPEDHVLVHEDAHQEVLQHSRQ
KRATCDLLSKWNWNHTACAGHCIAKGFKGGYCNDKAVCVCRN*

BS17041.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:53:50
Subject Length Description Subject Range Query Range Score Percent Strand
Def-PA 92 CG1385-PA 1..92 1..92 509 100 Plus