Clone BS17076 Report

Search the DGRC for BS17076

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:170
Well:76
Vector:pDNR-Dual
Associated Gene/TranscriptCG8498-RA
Protein status:BS17076.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS17076.5prime Sequence

303 bp (303 high quality bases) assembled on 2007-05-15

> BS17076.5prime
GAAGTTATCAGTCGACATGTCCGAATTGCAGGAATTCAACCAGGCGGCCG
AAGATGTTAAGAACCTAAACACCACACCCGGGGACAATGACCTTTTGGAG
CTCTACAGCTTGTACAAACAGGCCACTGTGGGGGATTGCAATACAGATAA
GCCCGGCTTTCTGGACTTCAAGGGCAAGGCCAAGTGGGAGGCGTGGAACA
ACCGCAAGGGAATGAGCAATACCGACGCCCAGGCCGCCTACATTACCAAG
GTCAAGGCACTGATCGCTGCCGTTGGCCTGAAGTCATAGAAGCTTTCTAG
ACC

BS17076.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:56:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG8498-PA 273 CG8498-RA 1..273 17..289 1365 100 Plus
CG8627-PB 261 Dbi-RB 151..182 170..201 135 96.8 Plus
CG8627-PA 261 Dbi-RA 151..182 170..201 135 96.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 05:29:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG8498-RB 525 CG8498-RB 128..401 17..290 1370 100 Plus
CG8498-RA 491 CG8498-RA 94..367 17..290 1370 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 05:29:18
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8161920..8162071 290..139 745 99.3 Minus
2L 23513712 2L 8162123..8162240 146..29 590 100 Minus
Blast to na_te.dros performed on 2015-02-12 05:29:20 has no hits.

BS17076.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:56:23 Download gff for BS17076.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8498-PA 1..273 17..289 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 05:42:40 Download gff for BS17076.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8498-RA 94..369 17..294 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:32:08 Download gff for BS17076.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8498-RA 94..369 17..294 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:32:08 Download gff for BS17076.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 8161918..8162063 147..294 98 <- Minus
2L 8162123..8162237 32..146 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 05:42:40 Download gff for BS17076.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8161918..8162063 147..294 98 <- Minus
arm_2L 8162123..8162237 32..146 100 <- Minus

BS17076.3prime Sequence

303 bp (303 high quality bases) assembled on 2007-05-15

> BS17076.3prime
ATGGTCTAGAAAGCTTCTATGACTTCAGGCCAACGGCAGCGATCAGTGCC
TTGACCTTGGTAATGTAGGCGGCCTGGGCGTCGGTATTGCTCATTCCCTT
GCGGTTGTTCCACGCCTCCCACTTGGCCTTGCCCTTGAAGTCCAGAAAGC
CGGGCTTATCTGTATTGCAATCCCCCACAGTGGCCTGTTTGTACAAGCTG
TAGAGCTCCAAAAGGTCATTGTCCCCGGGTGTGGTGTTTAGGTTCTTAAC
ATCTTCGGCCGCCTGGTTGAATTCCTGCAATTCGGACATGTCGACTGATA
ACT

BS17076.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:00:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG8498-PA 273 CG8498-RA 1..273 289..17 1365 100 Minus
CG8627-PB 261 Dbi-RB 151..182 136..105 135 96.8 Minus
CG8627-PA 261 Dbi-RA 151..182 136..105 135 96.8 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:20:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG8498-RB 525 CG8498-RB 128..401 289..16 1370 100 Minus
CG8498-RA 491 CG8498-RA 94..367 289..16 1370 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:20:31
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8161920..8162071 16..167 745 99.3 Plus
2L 23513712 2L 8162123..8162240 160..277 590 100 Plus
Blast to na_te.dros performed on 2015-02-10 21:20:34 has no hits.

BS17076.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:00:33 Download gff for BS17076.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8498-PA 1..273 17..289 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 11:13:18 Download gff for BS17076.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8498-RA 94..369 12..289 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:57:48 Download gff for BS17076.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8498-RA 94..369 12..289 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:57:48 Download gff for BS17076.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 8161918..8162063 12..159 98 <- Plus
2L 8162123..8162237 160..274 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 11:13:18 Download gff for BS17076.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8161918..8162063 12..159 98 <- Plus
arm_2L 8162123..8162237 160..274 100 <- Plus

BS17076.complete Sequence

305 bp assembled on 2007-05-08

GenBank Submission: FJ638246

> BS17076.complete
GAAGTTATCAGTCGACATGTCCGAATTGCAGGAATTCAACCAGGCGGCCG
AAGATGTTAAGAACCTAAACACCACACCCGGGGACAATGACCTTTTGGAG
CTCTACAGCTTGTACAAACAGGCCACTGTGGGGGATTGCAATACAGATAA
GCCCGGCTTTCTGGACTTCAAGGGCAAGGCCAAGTGGGAGGCGTGGAACA
ACCGCAAGGGAATGAGCAATACCGACGCCCAGGCCGCCTACATTACCAAG
GTCAAGGCACTGATCGCTGCCGTTGGCCTGAAGTCATAGAAGCTTTCTAG
ACCAT

BS17076.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 23:33:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG8498-RB 273 CG8498-PB 1..273 17..289 1365 100 Plus
CG8498-RA 273 CG8498-PA 1..273 17..289 1365 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 23:33:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG8498-RB 525 CG8498-RB 128..401 17..290 1370 100 Plus
CG8498-RA 491 CG8498-RA 94..367 17..290 1370 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 23:33:41
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8161920..8162071 290..139 745 99.3 Minus
2L 23513712 2L 8162123..8162240 146..29 590 100 Minus
Blast to na_te.dros performed on 2014-11-27 23:33:42 has no hits.

BS17076.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:29:00 Download gff for BS17076.complete
Subject Subject Range Query Range Percent Splice Strand
CG8498-RA 1..273 17..289 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:00:57 Download gff for BS17076.complete
Subject Subject Range Query Range Percent Splice Strand
CG8498-RA 65..340 17..294 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:31:52 Download gff for BS17076.complete
Subject Subject Range Query Range Percent Splice Strand
CG8498-RA 94..366 17..289 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:29:00 Download gff for BS17076.complete
Subject Subject Range Query Range Percent Splice Strand
CG8498-RA 65..340 17..294 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:03:19 Download gff for BS17076.complete
Subject Subject Range Query Range Percent Splice Strand
CG8498-RA 94..366 17..289 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:03:19 Download gff for BS17076.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8161921..8162063 147..289 100 <- Minus
2L 8162123..8162237 32..146 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:31:52 Download gff for BS17076.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8161921..8162063 147..289 100 <- Minus
arm_2L 8162123..8162237 32..146 100 <- Minus

BS17076.pep Sequence

Translation from 16 to 288

> BS17076.pep
MSELQEFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLD
FKGKAKWEAWNNRKGMSNTDAQAAYITKVKALIAAVGLKS*

BS17076.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:27:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG8498-PB 90 CG8498-PB 1..90 1..90 470 100 Plus
CG8498-PA 90 CG8498-PA 1..90 1..90 470 100 Plus
Dbi-PA 86 CG8627-PA 4..83 5..84 251 58.8 Plus
Dbi-PB 86 CG8627-PB 4..83 5..84 251 58.8 Plus
CG8629-PA 84 CG8629-PA 4..73 7..76 206 55.7 Plus