Clone BS17080 Report

Search the DGRC for BS17080

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:170
Well:80
Vector:pDNR-Dual
Associated Gene/TranscriptCG12994-RA
Protein status:BS17080.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS17080.5prime Sequence

234 bp (234 high quality bases) assembled on 2007-05-15

> BS17080.5prime
GAAGTTATCAGTCGACATGCCAGCGGGTCGAGTGGCTGGCAAGGCCGGCT
ACTCCAATCACTACTACAATGGACGCTCCTATGTGGGCATCAACGAGGAG
ATCATGTGGGTAAGCATCGGCATGGGCGTGACCATAGTGCTCCTGATCAC
GATCGCCTTGTGCTACATTGCGCGCGAGAAGTGCCAGAAGAGGCAGCGGG
AGTACTACGTGACCGCATAGAAGCTTTCTAGACC

BS17080.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:54:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG12994-PA 204 CG12994-RA 1..204 17..220 1020 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:45:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG12994-RA 1165 CG12994-RA 426..629 17..220 1020 100 Plus
CG17193-RC 3568 CG17193-RC 269..386 87..207 265 81.8 Plus
CG17193-RB 3915 CG17193-RB 616..733 87..207 265 81.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 17:45:07
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 17422856..17423005 220..71 750 100 Minus
X 23542271 X 17423071..17423126 72..17 280 100 Minus
3R 32079331 3R 20039616..20039720 191..87 240 81.9 Minus
Blast to na_te.dros performed on 2015-02-10 17:45:10 has no hits.

BS17080.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:54:47 Download gff for BS17080.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12994-PA 1..204 17..220 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-15 06:17:20 Download gff for BS17080.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12994-RA 419..634 8..226 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:42:02 Download gff for BS17080.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12994-RA 419..634 8..226 96   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:42:02 Download gff for BS17080.5prime
Subject Subject Range Query Range Percent Splice Strand
X 17422851..17423004 72..226 98 <- Minus
X 17423072..17423133 8..71 93   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-15 06:17:20 Download gff for BS17080.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 17316884..17317037 72..226 98 <- Minus
arm_X 17317105..17317166 8..71 93   Minus

BS17080.3prime Sequence

234 bp (234 high quality bases) assembled on 2007-05-15

> BS17080.3prime
ATGGTCTAGAAAGCTTCTATGCGGTCACGTAGTACTCCCGCTGCCTCTTC
TGGCACTTCTCGCGCGCAATGTAGCACAAGGCGATCGTGATCAGGAGCAC
TATGGTCACGCCCATGCCGATGCTTACCCACATGATCTCCTCGTTGATGC
CCACATAGGAGCGTCCATTGTAGTAGTGATTGGAGTAGCCGGCCTTGCCA
GCCACTCGACCCGCTGGCATGTCGACTGATAACT

BS17080.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:58:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG12994-PA 204 CG12994-RA 1..204 220..17 1020 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 06:55:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG12994-RA 1165 CG12994-RA 426..629 220..17 1020 100 Minus
CG17193-RC 3568 CG17193-RC 269..386 150..30 265 81.8 Minus
CG17193-RB 3915 CG17193-RB 616..733 150..30 265 81.8 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 06:55:01
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 17422856..17423005 17..166 750 100 Plus
X 23542271 X 17423071..17423126 165..220 280 100 Plus
3R 32079331 3R 20039616..20039720 46..150 240 81.9 Plus
Blast to na_te.dros performed on 2015-02-13 06:55:02 has no hits.

BS17080.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:58:37 Download gff for BS17080.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12994-PA 1..204 17..220 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 20:23:52 Download gff for BS17080.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12994-RA 419..634 11..229 96   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 09:16:36 Download gff for BS17080.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12994-RA 419..634 11..229 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 09:16:36 Download gff for BS17080.3prime
Subject Subject Range Query Range Percent Splice Strand
X 17422851..17423004 11..165 98 <- Plus
X 17423072..17423133 166..229 93   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 20:23:52 Download gff for BS17080.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 17316884..17317037 11..165 98 <- Plus
arm_X 17317105..17317166 166..229 93   Plus

BS17080.complete Sequence

236 bp assembled on 2007-05-08

GenBank Submission: FJ638249

> BS17080.complete
GAAGTTATCAGTCGACATGCCAGCGGGTCGAGTGGCTGGCAAGGCCGGCT
ACTCCAATCACTACTACAATGGACGCTCCTATGTGGGCATCAACGAGGAG
ATCATGTGGGTAAGCATCGGCATGGGCGTGACCATAGTGCTCCTGATCAC
GATCGCCTTGTGCTACATTGCGCGCGAGAAGTGCCAGAAGAGGCAGCGGG
AGTACTACGTGACCGCATAGAAGCTTTCTAGACCAT

BS17080.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:28:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG12994-RA 204 CG12994-PA 1..204 17..220 1020 100 Plus
CG17193-RC 207 CG17193-PC 77..181 87..191 240 81.9 Plus
CG17193-RB 207 CG17193-PB 77..181 87..191 240 81.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:28:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG12994-RA 1165 CG12994-RA 426..629 17..220 1020 100 Plus
CG17193-RC 3568 CG17193-RC 269..373 87..191 240 81.9 Plus
CG17193-RB 3915 CG17193-RB 616..720 87..191 240 81.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:28:05
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 17422856..17423005 220..71 750 100 Minus
X 23542271 X 17423071..17423126 72..17 280 100 Minus
3R 32079331 3R 20039616..20039720 191..87 240 81.9 Minus
Blast to na_te.dros performed on 2014-11-27 07:28:06 has no hits.

BS17080.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:29:02 Download gff for BS17080.complete
Subject Subject Range Query Range Percent Splice Strand
CG12994-RA 1..204 17..220 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:01:01 Download gff for BS17080.complete
Subject Subject Range Query Range Percent Splice Strand
CG12994-RA 419..634 8..226 96   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:15:50 Download gff for BS17080.complete
Subject Subject Range Query Range Percent Splice Strand
CG12994-RA 426..629 17..220 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:29:02 Download gff for BS17080.complete
Subject Subject Range Query Range Percent Splice Strand
CG12994-RA 419..634 8..226 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:11:15 Download gff for BS17080.complete
Subject Subject Range Query Range Percent Splice Strand
CG12994-RA 426..629 17..220 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:11:15 Download gff for BS17080.complete
Subject Subject Range Query Range Percent Splice Strand
X 17422856..17423004 72..220 100 <- Minus
X 17423072..17423126 17..71 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:15:50 Download gff for BS17080.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 17316889..17317037 72..220 100 <- Minus
arm_X 17317105..17317159 17..71 100   Minus

BS17080.pep Sequence

Translation from 16 to 219

> BS17080.pep
MPAGRVAGKAGYSNHYYNGRSYVGINEEIMWVSIGMGVTIVLLITIALCY
IAREKCQKRQREYYVTA*

BS17080.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:27:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG12994-PA 67 CG12994-PA 1..67 1..67 353 100 Plus
CG17193-PC 68 CG17193-PC 5..68 4..67 216 69.2 Plus
CG17193-PB 68 CG17193-PB 5..68 4..67 216 69.2 Plus
CG17193-PA 68 CG17193-PA 5..68 4..67 216 69.2 Plus