Clone BS17093 Report

Search the DGRC for BS17093

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:170
Well:93
Vector:pDNR-Dual
Associated Gene/TranscriptCG15579-RA
Protein status:BS17093.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS17093.3prime Sequence

315 bp (315 high quality bases) assembled on 2007-05-15

> BS17093.3prime
ATGGTCTAGAAAGCTTTTAACTCCTTAGCATTGCTTTCGCTGTGTGGCGT
CTCCCTTTCTTGCCGCCGCTCGGCTGCGTCTCGTCCCAGTAGCCGCAGGC
CAGCGTGAACAGCCCGTCCTCAATGGCCAGGAAACCGTGCATCCAGCCGG
CGGTCAGCGTGTTATCCACCGCCAGTCGCACCTCGTCAACAGTCTTGGCC
TCCATTTCGGCCACATACGAAGCCACCTCGTCCAGGTTGAGTGGACGATG
GAATACGTTGAAGGCCTCCAAAATGTGGTCAGCGTACAGGTAACGCGCCA
TGTCGACTGATAACT

BS17093.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:59:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG15579-PA 285 CG15579-RA 1..285 301..17 1425 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 06:05:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG15579-RB 521 CG15579-RB 97..381 301..17 1425 100 Minus
CG15579-RA 436 CG15579-RA 97..381 301..17 1425 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 06:05:36
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4311419..4311703 17..301 1425 100 Plus
Blast to na_te.dros performed 2015-02-13 06:05:40
Subject Length Description Subject Range Query Range Score Percent Strand
invader4 3105 invader4 INVADER4 3105bp 1105..1164 62..1 107 66.1 Minus

BS17093.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:59:12 Download gff for BS17093.3prime
Subject Subject Range Query Range Percent Splice Strand
CG15579-PA 1..285 17..301 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 18:48:56 Download gff for BS17093.3prime
Subject Subject Range Query Range Percent Splice Strand
CG15579-RA 97..384 14..301 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 08:03:21 Download gff for BS17093.3prime
Subject Subject Range Query Range Percent Splice Strand
CG15579-RA 97..384 14..301 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 08:03:21 Download gff for BS17093.3prime
Subject Subject Range Query Range Percent Splice Strand
X 4311416..4311703 14..301 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 18:48:56 Download gff for BS17093.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 4205449..4205736 14..301 99   Plus

BS17093.5prime Sequence

315 bp (315 high quality bases) assembled on 2007-05-15

> BS17093.5prime
GAAGTTATCAGTCGACATGGCGCGTTACCTGTACGCTGACCACATTTTGG
AGGCCTTCAACGTATTCCATCGTCCACTCAACCTGGACGAGGTGGCTTCG
TATGTGGCCGAAATGGAGGCCAAGACTGTTGACGAGGTGCGACTGGCGGT
GGATAACACGCTGACCGCCGGCTGGATGCACGGTTTCCTGGCCATTGAGG
ACGGGCTGTTCACGCTGGCCTGCGGCTACTGGGACGAGACGCAGCCGAGC
GGCGGCAAGAAAGGGAGACGCCACACAGCGAAAGCAATGCTAAGGAGTTA
AAAGCTTTCTAGACC

BS17093.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:55:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG15579-PA 285 CG15579-RA 1..285 17..301 1425 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:37:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG15579-RB 521 CG15579-RB 97..381 17..301 1425 100 Plus
CG15579-RA 436 CG15579-RA 97..381 17..301 1425 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:37:38
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4311419..4311703 301..17 1425 100 Minus
Blast to na_te.dros performed on 2015-02-12 10:37:39 has no hits.

BS17093.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:55:18 Download gff for BS17093.5prime
Subject Subject Range Query Range Percent Splice Strand
CG15579-PA 1..285 17..301 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 20:50:38 Download gff for BS17093.5prime
Subject Subject Range Query Range Percent Splice Strand
CG15579-RA 97..384 17..304 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:14:11 Download gff for BS17093.5prime
Subject Subject Range Query Range Percent Splice Strand
CG15579-RA 97..384 17..304 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:14:11 Download gff for BS17093.5prime
Subject Subject Range Query Range Percent Splice Strand
X 4311416..4311703 17..304 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 20:50:38 Download gff for BS17093.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 4205449..4205736 17..304 99   Minus

BS17093.complete Sequence

317 bp assembled on 2007-05-08

GenBank Submission: FJ638252

> BS17093.complete
GAAGTTATCAGTCGACATGGCGCGTTACCTGTACGCTGACCACATTTTGG
AGGCCTTCAACGTATTCCATCGTCCACTCAACCTGGACGAGGTGGCTTCG
TATGTGGCCGAAATGGAGGCCAAGACTGTTGACGAGGTGCGACTGGCGGT
GGATAACACGCTGACCGCCGGCTGGATGCACGGTTTCCTGGCCATTGAGG
ACGGGCTGTTCACGCTGGCCTGCGGCTACTGGGACGAGACGCAGCCGAGC
GGCGGCAAGAAAGGGAGACGCCACACAGCGAAAGCAATGCTAAGGAGTTA
AAAGCTTTCTAGACCAT

BS17093.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:08:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG15579-RB 285 CG15579-PB 1..285 17..301 1425 100 Plus
CG15579-RA 285 CG15579-PA 1..285 17..301 1425 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:08:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG15579-RB 521 CG15579-RB 97..381 17..301 1425 100 Plus
CG15579-RA 436 CG15579-RA 97..381 17..301 1425 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:08:34
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4311419..4311703 301..17 1425 100 Minus
Blast to na_te.dros performed 2014-11-27 08:08:35
Subject Length Description Subject Range Query Range Score Percent Strand
invader4 3105 invader4 INVADER4 3105bp 1105..1164 256..317 107 66.1 Plus

BS17093.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:46:20 Download gff for BS17093.complete
Subject Subject Range Query Range Percent Splice Strand
CG15579-RA 1..285 17..301 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:34:01 Download gff for BS17093.complete
Subject Subject Range Query Range Percent Splice Strand
CG15579-RA 97..384 17..304 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:55:46 Download gff for BS17093.complete
Subject Subject Range Query Range Percent Splice Strand
CG15579-RA 97..379 17..299 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:46:20 Download gff for BS17093.complete
Subject Subject Range Query Range Percent Splice Strand
CG15579-RA 1..285 17..301 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:11:50 Download gff for BS17093.complete
Subject Subject Range Query Range Percent Splice Strand
CG15579-RA 97..379 17..299 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:11:50 Download gff for BS17093.complete
Subject Subject Range Query Range Percent Splice Strand
X 4311421..4311703 17..299 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:55:46 Download gff for BS17093.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 4205454..4205736 17..299 100   Minus

BS17093.pep Sequence

Translation from 16 to 300

> BS17093.pep
MARYLYADHILEAFNVFHRPLNLDEVASYVAEMEAKTVDEVRLAVDNTLT
AGWMHGFLAIEDGLFTLACGYWDETQPSGGKKGRRHTAKAMLRS*

BS17093.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:40:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG15579-PB 94 CG15579-PB 1..94 1..94 497 100 Plus
CG15579-PA 94 CG15579-PA 1..94 1..94 497 100 Plus