Clone Sequence Records
BS17096.5prime Sequence
243 bp (243 high quality bases) assembled on 2007-05-15
> BS17096.5prime
GAAGTTATCAGTCGACATGCAGAAGAAGCCGATTAACACCAACACGCTGC
TGGACAAGCTGCACCGCGGCGCGGTGTATGCCTGCATTGGAGTCACCCTG
TACGGCACCTACATCCTGGGAATGCGCTACTACCACTACTGCACGGTCAT
CCGACCGGAGAAGCAGCAGGCGGAGCTGAAGCTCCTGGACGAGGGAGCCC
ACGACAAGGCCAAGGAACTGAAGTACTAGAAGCTTTCTAGACC
BS17096.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:56:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17776-PA | 213 | CG17776-RA | 1..213 | 17..229 | 1065 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:16:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17776-RB | 534 | CG17776-RB | 240..453 | 16..229 | 1070 | 100 | Plus |
CG17776-RA | 372 | CG17776-RA | 78..291 | 16..229 | 1070 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:16:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 2184964..2185177 | 16..229 | 1070 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-10 21:16:51 has no hits.
BS17096.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 17:57:01 Download gff for
BS17096.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17776-PA | 1..213 | 17..229 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 11:12:40 Download gff for
BS17096.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17776-RA | 69..293 | 7..233 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:57:18 Download gff for
BS17096.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17776-RA | 69..293 | 7..233 | 97 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:57:18 Download gff for
BS17096.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 2184955..2185179 | 7..233 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 11:12:40 Download gff for
BS17096.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 2078988..2079212 | 7..233 | 97 | | Plus |
BS17096.3prime Sequence
243 bp (243 high quality bases) assembled on 2007-05-15
> BS17096.3prime
ATGGTCTAGAAAGCTTCTAGTACTTCAGTTCCTTGGCCTTGTCGTGGGCT
CCCTCGTCCAGGAGCTTCAGCTCCGCCTGCTGCTTCTCCGGTCGGATGAC
CGTGCAGTAGTGGTAGTAGCGCATTCCCAGGATGTAGGTGCCGTACAGGG
TGACTCCAATGCAGGCATACACCGCGCCGCGGTGCAGCTTGTCCAGCAGC
GTGTTGGTGTTAATCGGCTTCTTCTGCATGTCGACTGATAACT
BS17096.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:01:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17776-PA | 213 | CG17776-RA | 1..213 | 229..17 | 1065 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 05:32:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17776-RB | 534 | CG17776-RB | 240..453 | 230..17 | 1070 | 100 | Minus |
CG17776-RA | 372 | CG17776-RA | 78..291 | 230..17 | 1070 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 05:32:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 2184964..2185177 | 230..17 | 1070 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-12 05:32:32 has no hits.
BS17096.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:01:22 Download gff for
BS17096.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17776-PA | 1..213 | 17..229 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 05:43:31 Download gff for
BS17096.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17776-RA | 69..293 | 13..239 | 97 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:39:50 Download gff for
BS17096.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17776-RA | 69..293 | 13..239 | 97 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:39:50 Download gff for
BS17096.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 2184955..2185179 | 13..239 | 97 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 05:43:31 Download gff for
BS17096.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 2078988..2079212 | 13..239 | 97 | | Minus |
BS17096.complete Sequence
245 bp assembled on 2007-05-08
GenBank Submission: FJ638254
> BS17096.complete
GAAGTTATCAGTCGACATGCAGAAGAAGCCGATTAACACCAACACGCTGC
TGGACAAGCTGCACCGCGGCGCGGTGTATGCCTGCATTGGAGTCACCCTG
TACGGCACCTACATCCTGGGAATGCGCTACTACCACTACTGCACGGTCAT
CCGACCGGAGAAGCAGCAGGCGGAGCTGAAGCTCCTGGACGAGGGAGCCC
ACGACAAGGCCAAGGAACTGAAGTACTAGAAGCTTTCTAGACCAT
BS17096.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:21:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17776-RB | 213 | CG17776-PB | 1..213 | 17..229 | 1065 | 100 | Plus |
CG17776-RA | 213 | CG17776-PA | 1..213 | 17..229 | 1065 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:21:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17776-RB | 534 | CG17776-RB | 240..453 | 16..229 | 1070 | 100 | Plus |
CG17776-RA | 372 | CG17776-RA | 78..291 | 16..229 | 1070 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:21:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 2184964..2185177 | 16..229 | 1070 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 15:21:36 has no hits.
BS17096.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:11:35 Download gff for
BS17096.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17776-RA | 1..213 | 17..229 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:13:30 Download gff for
BS17096.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17776-RA | 16..240 | 7..233 | 97 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:50:05 Download gff for
BS17096.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17776-RA | 79..291 | 17..229 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:11:36 Download gff for
BS17096.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17776-RA | 16..240 | 7..233 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:05:49 Download gff for
BS17096.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17776-RA | 79..291 | 17..229 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:05:49 Download gff for
BS17096.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 2184965..2185177 | 17..229 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:50:05 Download gff for
BS17096.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 2078998..2079210 | 17..229 | 100 | | Plus |
BS17096.pep Sequence
Translation from 16 to 228
> BS17096.pep
MQKKPINTNTLLDKLHRGAVYACIGVTLYGTYILGMRYYHYCTVIRPEKQ
QAELKLLDEGAHDKAKELKY*
BS17096.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:35:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17776-PB | 70 | CG17776-PB | 1..70 | 1..70 | 374 | 100 | Plus |
CG17776-PA | 70 | CG17776-PA | 1..70 | 1..70 | 374 | 100 | Plus |