Clone Sequence Records
BS17149.5prime Sequence
231 bp (231 high quality bases) assembled on 2007-05-15
> BS17149.5prime
GAAGTTATCAGTCGACATGATTCGAATTTTGGTTTTAATGATTACATTCA
CTCTAATGACTGGTAGCGCTCTTTGTTCTATCGAGCAACTTATGCGGGTC
TTTGGCGGTGGATCTGTTGGAGGAGGTTCTAGGCTGGACATCAACAGAAG
GGTAACTATAGTACCACCCGAAGGCGAACTCTCGTTTGGATATGGCTTTC
GTCCTGGATTCTATTGAAAGCTTTCTAGACC
BS17149.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:01:45
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG2665-PA | 201 | PebII-RA | 1..201 | 17..217 | 1005 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:55:43
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| PebII-RB | 608 | CG2665-RB | 48..249 | 16..217 | 1010 | 100 | Plus |
| PebII-RA | 379 | CG2665-RA | 48..249 | 16..217 | 1010 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:55:39
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2R | 25286936 | 2R | 25173927..25174113 | 217..31 | 935 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-12 10:55:41 has no hits.
BS17149.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:01:47 Download gff for
BS17149.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG2665-PA | 1..201 | 17..217 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 20:52:05 Download gff for
BS17149.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| PebII-RA | 21..228 | 9..224 | 96 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:26:17 Download gff for
BS17149.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| PebII-RA | 45..252 | 9..224 | 96 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:26:17 Download gff for
BS17149.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 25173924..25174112 | 32..224 | 97 | <- | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 20:52:05 Download gff for
BS17149.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2R | 21061447..21061635 | 32..224 | 97 | <- | Minus |
BS17149.3prime Sequence
231 bp (231 high quality bases) assembled on 2007-05-15
> BS17149.3prime
ATGGTCTAGAAAGCTTTCCATAGAATCCAGGACGAAAGCCATATCCAAAC
GAGAGTTCGCCTTCGGGTGGTACTATAGTTACCCTTCTGTTGATGTCCAG
CCTAGAACCTCCTCCAACAGATCCACCGCCAAAGACCCGCATAAGTTGCT
CGATAGAACAAAGAGCGCTACCAGTCATTAGAGTGAATGTAATCATTAAA
ACCAAAATTCGAATCATGTCGACTGATAACT
BS17149.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:06:00
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG2665-PA | 201 | PebII-RA | 1..198 | 217..20 | 990 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:33:32
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| PebII-RB | 608 | CG2665-RB | 48..246 | 218..20 | 995 | 100 | Minus |
| PebII-RA | 379 | CG2665-RA | 48..246 | 218..20 | 995 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:33:24
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2R | 25286936 | 2R | 25173930..25174113 | 20..203 | 920 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-10 21:33:28 has no hits.
BS17149.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:06:02 Download gff for
BS17149.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG2665-PA | 1..201 | 17..217 | 99 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 11:14:55 Download gff for
BS17149.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| PebII-RA | 21..225 | 17..225 | 97 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:59:31 Download gff for
BS17149.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| PebII-RA | 45..249 | 17..225 | 97 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:59:31 Download gff for
BS17149.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 25173927..25174112 | 17..202 | 99 | <- | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 11:14:55 Download gff for
BS17149.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2R | 21061450..21061635 | 17..202 | 99 | <- | Plus |
BS17149.complete Sequence
233 bp assembled on 2007-05-08
GenBank Submission: FJ638256
> BS17149.complete
GAAGTTATCAGTCGACATGATTCGAATTTTGGTTTTAATGATTACATTCA
CTCTAATGACTGGTAGCGCTCTTTGTTCTATCGAGCAACTTATGCGGGTC
TTTGGCGGTGGATCTGTTGGAGGAGGTTCTAGGCTGGACATCAACAGAAG
GGTAACTATAGTACCACCCGAAGGCGAACTCTCGTTTGGATATGGCTTTC
GTCCTGGATTCTATTGAAAGCTTTCTAGACCAT
BS17149.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:21:57
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| PebII-RB | 201 | CG2665-PB | 1..201 | 17..217 | 1005 | 100 | Plus |
| PebII-RA | 201 | CG2665-PA | 1..201 | 17..217 | 1005 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:21:58
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| PebII-RB | 608 | CG2665-RB | 48..249 | 16..217 | 1010 | 100 | Plus |
| PebII-RA | 379 | CG2665-RA | 48..249 | 16..217 | 1010 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:21:55
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2R | 25286936 | 2R | 25173927..25174113 | 217..31 | 935 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-27 15:21:56 has no hits.
BS17149.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:45:00 Download gff for
BS17149.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| PebII-RA | 1..201 | 17..217 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:11:05 Download gff for
BS17149.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| PebII-RA | 21..228 | 9..224 | 96 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:40:05 Download gff for
BS17149.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| PebII-RA | 25..224 | 17..216 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:45:00 Download gff for
BS17149.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| PebII-RA | 1..210 | 12..224 | 96 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:05:58 Download gff for
BS17149.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| PebII-RA | 49..248 | 17..216 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:05:58 Download gff for
BS17149.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 25173928..25174112 | 32..216 | 100 | <- | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:40:05 Download gff for
BS17149.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2R | 21061451..21061635 | 32..216 | 100 | <- | Minus |
BS17149.pep Sequence
Translation from 16 to 216
> BS17149.pep
MIRILVLMITFTLMTGSALCSIEQLMRVFGGGSVGGGSRLDINRRVTIVP
PEGELSFGYGFRPGFY*
BS17149.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:37:56
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| PebII-PB | 66 | CG2665-PB | 1..66 | 1..66 | 338 | 100 | Plus |
| PebII-PA | 66 | CG2665-PA | 1..66 | 1..66 | 338 | 100 | Plus |
