Clone Sequence Records
BS17177.3prime Sequence
225 bp (225 high quality bases) assembled on 2007-05-15
> BS17177.3prime
ATGGTCTAGAAAGCTTTTAGTAAATGGGCTCCGGCTTCTGGGTGAGCAGC
AGTCCAAAGCGCTTCTTGATGGTCAGCCTCTGGCGGGAGTACTTATCCTC
CGGTGAAAAACGTGCTGGATGAGCAGATAGTGTGGGACGACCATCCTCGG
TGCGTTTCTTCAGGGTGTAAACGCGATCGCCGTTTTCGTTAATTGTGTAC
ATCAGATACATGTCGACTGATAACT
BS17177.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:09:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7637-PA | 195 | CG7637-RA | 1..195 | 211..17 | 975 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 05:37:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7637-RA | 316 | CG7637-RA | 61..255 | 211..17 | 975 | 100 | Minus |
CG12935-RB | 918 | CG12935-RB | 880..918 | 17..55 | 195 | 100 | Plus |
CG12935-RA | 1200 | CG12935-RA | 1162..1200 | 17..55 | 195 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 05:37:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 10810617..10810759 | 17..159 | 715 | 100 | Plus |
2R | 25286936 | 2R | 10810823..10810876 | 158..211 | 270 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-12 05:37:36 has no hits.
BS17177.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:09:17 Download gff for
BS17177.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7637-PA | 1..195 | 17..211 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 05:44:51 Download gff for
BS17177.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7637-RA | 61..257 | 13..211 | 98 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:43:19 Download gff for
BS17177.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7637-RA | 61..257 | 13..211 | 98 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:43:19 Download gff for
BS17177.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 10810615..10810757 | 13..157 | 98 | <- | Plus |
2R | 10810823..10810876 | 158..211 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 05:44:51 Download gff for
BS17177.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 6698120..6698262 | 13..157 | 98 | <- | Plus |
arm_2R | 6698328..6698381 | 158..211 | 100 | | Plus |
BS17177.5prime Sequence
225 bp (225 high quality bases) assembled on 2007-05-15
> BS17177.5prime
GAAGTTATCAGTCGACATGTATCTGATGTACACAATTAACGAAAACGGCG
ATCGCGTTTACACCCTGAAGAAACGCACCGAGGATGGTCGTCCCACACTA
TCTGCTCATCCAGCACGTTTTTCACCGGAGGATAAGTACTCCCGCCAGAG
GCTGACCATCAAGAAGCGCTTTGGACTGCTGCTCACCCAGAAGCCGGAGC
CCATTTACTAAAAGCTTTCTAGACC
BS17177.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:05:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7637-PA | 195 | CG7637-RA | 1..195 | 17..211 | 975 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 16:38:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7637-RA | 316 | CG7637-RA | 61..255 | 17..211 | 975 | 100 | Plus |
CG12935-RB | 918 | CG12935-RB | 880..918 | 211..173 | 195 | 100 | Minus |
CG12935-RA | 1200 | CG12935-RA | 1162..1200 | 211..173 | 195 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 16:37:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 10810617..10810759 | 211..69 | 715 | 100 | Minus |
2R | 25286936 | 2R | 10810823..10810876 | 70..17 | 270 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-11 16:37:58 has no hits.
BS17177.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:05:01 Download gff for
BS17177.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7637-PA | 1..195 | 17..211 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 19:51:07 Download gff for
BS17177.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7637-RA | 61..257 | 17..215 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:43:33 Download gff for
BS17177.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7637-RA | 61..257 | 17..215 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:43:33 Download gff for
BS17177.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 10810615..10810757 | 71..215 | 98 | <- | Minus |
2R | 10810823..10810876 | 17..70 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 19:51:07 Download gff for
BS17177.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 6698120..6698262 | 71..215 | 98 | <- | Minus |
arm_2R | 6698328..6698381 | 17..70 | 100 | | Minus |
BS17177.complete Sequence
227 bp assembled on 2007-05-08
GenBank Submission: FJ638266
> BS17177.complete
GAAGTTATCAGTCGACATGTATCTGATGTACACAATTAACGAAAACGGCG
ATCGCGTTTACACCCTGAAGAAACGCACCGAGGATGGTCGTCCCACACTA
TCTGCTCATCCAGCACGTTTTTCACCGGAGGATAAGTACTCCCGCCAGAG
GCTGACCATCAAGAAGCGCTTTGGACTGCTGCTCACCCAGAAGCCGGAGC
CCATTTACTAAAAGCTTTCTAGACCAT
BS17177.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:09:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7637-RA | 195 | CG7637-PA | 1..195 | 17..211 | 975 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:09:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7637-RA | 316 | CG7637-RA | 61..255 | 17..211 | 975 | 100 | Plus |
CG12935-RB | 918 | CG12935-RB | 880..918 | 211..173 | 195 | 100 | Minus |
CG12935-RA | 1200 | CG12935-RA | 1162..1200 | 211..173 | 195 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:09:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 10810617..10810759 | 211..69 | 715 | 100 | Minus |
2R | 25286936 | 2R | 10810823..10810876 | 70..17 | 270 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-27 16:09:09 has no hits.
BS17177.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:19:16 Download gff for
BS17177.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7637-RA | 1..195 | 17..211 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:50:48 Download gff for
BS17177.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7637-RA | 15..211 | 17..215 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:50:03 Download gff for
BS17177.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7637-RA | 61..253 | 17..209 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:19:16 Download gff for
BS17177.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7637-RA | 15..211 | 17..215 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:12:01 Download gff for
BS17177.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7637-RA | 61..253 | 17..209 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:12:01 Download gff for
BS17177.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 10810619..10810757 | 71..209 | 100 | <- | Minus |
2R | 10810823..10810876 | 17..70 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:50:03 Download gff for
BS17177.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 6698124..6698262 | 71..209 | 100 | <- | Minus |
arm_2R | 6698328..6698381 | 17..70 | 100 | | Minus |
BS17177.pep Sequence
Translation from 16 to 210
> BS17177.pep
MYLMYTINENGDRVYTLKKRTEDGRPTLSAHPARFSPEDKYSRQRLTIKK
RFGLLLTQKPEPIY*
BS17177.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:18:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7637-PA | 64 | CG7637-PA | 1..64 | 1..64 | 337 | 100 | Plus |