Clone BS17177 Report

Search the DGRC for BS17177

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:171
Well:77
Vector:pDNR-Dual
Associated Gene/TranscriptCG7637-RA
Protein status:BS17177.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS17177.3prime Sequence

225 bp (225 high quality bases) assembled on 2007-05-15

> BS17177.3prime
ATGGTCTAGAAAGCTTTTAGTAAATGGGCTCCGGCTTCTGGGTGAGCAGC
AGTCCAAAGCGCTTCTTGATGGTCAGCCTCTGGCGGGAGTACTTATCCTC
CGGTGAAAAACGTGCTGGATGAGCAGATAGTGTGGGACGACCATCCTCGG
TGCGTTTCTTCAGGGTGTAAACGCGATCGCCGTTTTCGTTAATTGTGTAC
ATCAGATACATGTCGACTGATAACT

BS17177.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:09:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG7637-PA 195 CG7637-RA 1..195 211..17 975 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 05:37:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG7637-RA 316 CG7637-RA 61..255 211..17 975 100 Minus
CG12935-RB 918 CG12935-RB 880..918 17..55 195 100 Plus
CG12935-RA 1200 CG12935-RA 1162..1200 17..55 195 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 05:37:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10810617..10810759 17..159 715 100 Plus
2R 25286936 2R 10810823..10810876 158..211 270 100 Plus
Blast to na_te.dros performed on 2015-02-12 05:37:36 has no hits.

BS17177.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:09:17 Download gff for BS17177.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7637-PA 1..195 17..211 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 05:44:51 Download gff for BS17177.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7637-RA 61..257 13..211 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:43:19 Download gff for BS17177.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7637-RA 61..257 13..211 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:43:19 Download gff for BS17177.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 10810615..10810757 13..157 98 <- Plus
2R 10810823..10810876 158..211 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 05:44:51 Download gff for BS17177.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6698120..6698262 13..157 98 <- Plus
arm_2R 6698328..6698381 158..211 100   Plus

BS17177.5prime Sequence

225 bp (225 high quality bases) assembled on 2007-05-15

> BS17177.5prime
GAAGTTATCAGTCGACATGTATCTGATGTACACAATTAACGAAAACGGCG
ATCGCGTTTACACCCTGAAGAAACGCACCGAGGATGGTCGTCCCACACTA
TCTGCTCATCCAGCACGTTTTTCACCGGAGGATAAGTACTCCCGCCAGAG
GCTGACCATCAAGAAGCGCTTTGGACTGCTGCTCACCCAGAAGCCGGAGC
CCATTTACTAAAAGCTTTCTAGACC

BS17177.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:05:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG7637-PA 195 CG7637-RA 1..195 17..211 975 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 16:38:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG7637-RA 316 CG7637-RA 61..255 17..211 975 100 Plus
CG12935-RB 918 CG12935-RB 880..918 211..173 195 100 Minus
CG12935-RA 1200 CG12935-RA 1162..1200 211..173 195 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 16:37:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10810617..10810759 211..69 715 100 Minus
2R 25286936 2R 10810823..10810876 70..17 270 100 Minus
Blast to na_te.dros performed on 2015-02-11 16:37:58 has no hits.

BS17177.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:05:01 Download gff for BS17177.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7637-PA 1..195 17..211 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 19:51:07 Download gff for BS17177.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7637-RA 61..257 17..215 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:43:33 Download gff for BS17177.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7637-RA 61..257 17..215 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:43:33 Download gff for BS17177.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 10810615..10810757 71..215 98 <- Minus
2R 10810823..10810876 17..70 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 19:51:07 Download gff for BS17177.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6698120..6698262 71..215 98 <- Minus
arm_2R 6698328..6698381 17..70 100   Minus

BS17177.complete Sequence

227 bp assembled on 2007-05-08

GenBank Submission: FJ638266

> BS17177.complete
GAAGTTATCAGTCGACATGTATCTGATGTACACAATTAACGAAAACGGCG
ATCGCGTTTACACCCTGAAGAAACGCACCGAGGATGGTCGTCCCACACTA
TCTGCTCATCCAGCACGTTTTTCACCGGAGGATAAGTACTCCCGCCAGAG
GCTGACCATCAAGAAGCGCTTTGGACTGCTGCTCACCCAGAAGCCGGAGC
CCATTTACTAAAAGCTTTCTAGACCAT

BS17177.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:09:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG7637-RA 195 CG7637-PA 1..195 17..211 975 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:09:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG7637-RA 316 CG7637-RA 61..255 17..211 975 100 Plus
CG12935-RB 918 CG12935-RB 880..918 211..173 195 100 Minus
CG12935-RA 1200 CG12935-RA 1162..1200 211..173 195 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:09:08
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10810617..10810759 211..69 715 100 Minus
2R 25286936 2R 10810823..10810876 70..17 270 100 Minus
Blast to na_te.dros performed on 2014-11-27 16:09:09 has no hits.

BS17177.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:19:16 Download gff for BS17177.complete
Subject Subject Range Query Range Percent Splice Strand
CG7637-RA 1..195 17..211 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:50:48 Download gff for BS17177.complete
Subject Subject Range Query Range Percent Splice Strand
CG7637-RA 15..211 17..215 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:50:03 Download gff for BS17177.complete
Subject Subject Range Query Range Percent Splice Strand
CG7637-RA 61..253 17..209 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:19:16 Download gff for BS17177.complete
Subject Subject Range Query Range Percent Splice Strand
CG7637-RA 15..211 17..215 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:12:01 Download gff for BS17177.complete
Subject Subject Range Query Range Percent Splice Strand
CG7637-RA 61..253 17..209 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:12:01 Download gff for BS17177.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10810619..10810757 71..209 100 <- Minus
2R 10810823..10810876 17..70 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:50:03 Download gff for BS17177.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6698124..6698262 71..209 100 <- Minus
arm_2R 6698328..6698381 17..70 100   Minus

BS17177.pep Sequence

Translation from 16 to 210

> BS17177.pep
MYLMYTINENGDRVYTLKKRTEDGRPTLSAHPARFSPEDKYSRQRLTIKK
RFGLLLTQKPEPIY*

BS17177.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:18:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG7637-PA 64 CG7637-PA 1..64 1..64 337 100 Plus