Clone BS17181 Report

Search the DGRC for BS17181

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:171
Well:81
Vector:pDNR-Dual
Associated Gene/TranscriptCG13306-RA
Protein status:BS17181.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS17181.5prime Sequence

315 bp (315 high quality bases) assembled on 2007-05-15

> BS17181.5prime
GAAGTTATCAGTCGACATGGTTCTGCTACTGGTGCACCTGCGGCGCCTTA
TTTTGCTGCTGACGGTCGTTTACCTGAGCGGAGCGGTATTCCGTCGCCTT
CTCACCGAACGGCACCACGCCCACATCCTGCAAGGCAATGGTTACATGGG
TTTCGGACGTCTTCGTGGTGGCGGTGGATCCAAGGAGCCGTATCACTTCC
AATGGTGGGCCTACATCTACACCTGTTATGCATACGCCGTGCTGGTCAAC
TACGTCAACATGCGCCGGCTGACCAACCTTATCGAATTTTTCTTGAATTA
AAAGCTTTCTAGACC

BS17181.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:03:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG13306-PA 285 CG13306-RA 1..285 17..301 1425 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 00:14:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG13306-RA 531 CG13306-RA 111..395 17..301 1425 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 00:14:48
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8749275..8749559 301..17 1425 100 Minus
Blast to na_te.dros performed on 2015-02-12 00:14:51 has no hits.

BS17181.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:03:09 Download gff for BS17181.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13306-PA 1..285 17..301 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 02:31:29 Download gff for BS17181.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13306-RA 111..400 17..307 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:59:48 Download gff for BS17181.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13306-RA 111..400 17..307 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 01:59:48 Download gff for BS17181.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 8749270..8749559 17..307 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 02:31:29 Download gff for BS17181.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8742370..8742659 17..307 98   Minus

BS17181.3prime Sequence

315 bp (315 high quality bases) assembled on 2007-05-15

> BS17181.3prime
ATGGTCTAGAAAGCTTTTAATTCAAGAAAAATTCGATAAGGTTGGTCAGC
CGGCGCATGTTGACGTAGTTGACCAGCACGGCGTATGCATAACAGGTGTA
GATGTAGGCCCACCATTGGAAGTGATACGGCTCCTTGGATCCACCGCCAC
CACGAAGACGTCCGAAACCCATGTAACCATTGCCTTGCAGGATGTGGGCG
TGGTGCCGTTCGGTGAGAAGGCGACGGAATACCGCTCCGCTCAGGTAAAC
GACCGTCAGCAGCAAAATAAGGCGCCGCAGGTGCACCAGTAGCAGAACCA
TGTCGACTGATAACT

BS17181.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:07:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG13306-PA 285 CG13306-RA 1..285 301..17 1425 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-04 21:03:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG13306-RA 531 CG13306-RA 111..395 301..17 1425 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-04 21:03:11
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8749275..8749559 17..301 1425 100 Plus
Blast to na_te.dros performed on 2015-02-04 21:03:13 has no hits.

BS17181.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:07:20 Download gff for BS17181.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13306-PA 1..285 17..301 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-10 21:38:30 Download gff for BS17181.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13306-RA 111..400 11..301 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-05 00:38:34 Download gff for BS17181.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13306-RA 111..400 11..301 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-05 00:38:34 Download gff for BS17181.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 8749270..8749559 11..301 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-10 21:38:30 Download gff for BS17181.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8742370..8742659 11..301 98   Plus

BS17181.complete Sequence

317 bp assembled on 2007-05-08

GenBank Submission: FJ638267

> BS17181.complete
GAAGTTATCAGTCGACATGGTTCTGCTACTGGTGCACCTGCGGCGCCTTA
TTTTGCTGCTGACGGTCGTTTACCTGAGCGGAGCGGTATTCCGTCGCCTT
CTCACCGAACGGCACCACGCCCACATCCTGCAAGGCAATGGTTACATGGG
TTTCGGACGTCTTCGTGGTGGCGGTGGATCCAAGGAGCCGTATCACTTCC
AATGGTGGGCCTACATCTACACCTGTTATGCATACGCCGTGCTGGTCAAC
TACGTCAACATGCGCCGGCTGACCAACCTTATCGAATTTTTCTTGAATTA
AAAGCTTTCTAGACCAT

BS17181.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:18:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG13306-RA 285 CG13306-PA 1..285 17..301 1425 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:18:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG13306-RA 531 CG13306-RA 111..395 17..301 1425 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:18:49
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8749275..8749559 301..17 1425 100 Minus
Blast to na_te.dros performed on 2014-11-28 00:18:50 has no hits.

BS17181.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:19:25 Download gff for BS17181.complete
Subject Subject Range Query Range Percent Splice Strand
CG13306-RA 1..285 17..301 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:50:59 Download gff for BS17181.complete
Subject Subject Range Query Range Percent Splice Strand
CG13306-RA 111..400 17..307 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:22:12 Download gff for BS17181.complete
Subject Subject Range Query Range Percent Splice Strand
CG13306-RA 111..393 17..299 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:19:25 Download gff for BS17181.complete
Subject Subject Range Query Range Percent Splice Strand
CG13306-RA 111..400 17..307 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:29:47 Download gff for BS17181.complete
Subject Subject Range Query Range Percent Splice Strand
CG13306-RA 111..393 17..299 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:29:47 Download gff for BS17181.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8749277..8749559 17..299 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:22:12 Download gff for BS17181.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8742377..8742659 17..299 100   Minus

BS17181.pep Sequence

Translation from 16 to 300

> BS17181.pep
MVLLLVHLRRLILLLTVVYLSGAVFRRLLTERHHAHILQGNGYMGFGRLR
GGGGSKEPYHFQWWAYIYTCYAYAVLVNYVNMRRLTNLIEFFLN*

BS17181.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:32:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG13306-PA 94 CG13306-PA 1..94 1..94 502 100 Plus