Clone BS17182 Report

Search the DGRC for BS17182

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:171
Well:82
Vector:pDNR-Dual
Associated Gene/Transcripte(y)2b-RA
Protein status:BS17182.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS17182.3prime Sequence

318 bp (318 high quality bases) assembled on 2007-05-15

> BS17182.3prime
ATGGTCTAGAAAGCTTCTACTTATCGAGGGCGGCGTGCACGCGCAGCATC
ATCTCATTTTTGACGACTTCAGGCACCAAAGCGCGAGCTTGCGGGACTAT
TTGGGCAGCCAGTTGGTCGCGGTTTATATTGTCCACTCCGCGCTCCATGA
TGATGTTTCGTATCATTTCCTTAATGTCCTTGTGCCATCCGCACTCCACA
AGACGCGTGTGCAGCAGTTCCTTCAGGGCGGCCTTATCTTGACTGCGTAA
CGTAGGCTTATATCCAGGATCGGGATCGGTTCCCGTTTCCTTGTTTATTG
TCATGTCGACTGATAACT

BS17182.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:09:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG14612-PA 288 CG14612-RA 1..288 304..17 1440 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:38:16
Subject Length Description Subject Range Query Range Score Percent Strand
e(y)2b-RB 662 CG14612-RB 189..477 305..17 1445 100 Minus
e(y)2b-RA 559 CG14612-RA 86..374 305..17 1445 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:38:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7094263..7094402 227..88 700 100 Minus
3R 32079331 3R 7094123..7094200 305..228 390 100 Minus
3R 32079331 3R 7094471..7094542 88..17 360 100 Minus
Blast to na_te.dros performed on 2015-02-10 21:38:12 has no hits.

BS17182.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:09:13 Download gff for BS17182.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14612-PA 1..288 17..304 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 11:15:39 Download gff for BS17182.3prime
Subject Subject Range Query Range Percent Splice Strand
e(y)2b-RA 80..374 17..309 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 00:00:12 Download gff for BS17182.3prime
Subject Subject Range Query Range Percent Splice Strand
e(y)2b-RA 80..374 17..309 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 00:00:12 Download gff for BS17182.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 7094117..7094200 228..309 97 -> Minus
3R 7094263..7094401 89..227 100 -> Minus
3R 7094471..7094542 17..88 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 11:15:39 Download gff for BS17182.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2919839..2919922 228..309 97 -> Minus
arm_3R 2919985..2920123 89..227 100 -> Minus
arm_3R 2920193..2920264 17..88 100   Minus

BS17182.5prime Sequence

318 bp (318 high quality bases) assembled on 2007-05-15

> BS17182.5prime
GAAGTTATCAGTCGACATGACAATAAACAAGGAAACGGGAACCGATCCCG
ATCCTGGATATAAGCCTACGTTACGCAGTCAAGATAAGGCCGCCCTGAAG
GAACTGCTGCACACGCGTCTTGTGGAGTGCGGATGGCACAAGGACATTAA
GGAAATGATACGAAACATCATCATGGAGCGCGGAGTGGACAATATAAACC
GCGACCAACTGGCTGCCCAAATAGTCCCGCAAGCTCGCGCTTTGGTGCCT
GAAGTCGTCAAAAATGAGATGATGCTGCGCGTGCACGCCGCCCTCGATAA
GTAGAAGCTTTCTAGACC

BS17182.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:04:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG14612-PA 288 CG14612-RA 1..288 17..304 1440 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 16:37:17
Subject Length Description Subject Range Query Range Score Percent Strand
e(y)2b-RB 662 CG14612-RB 189..477 16..304 1445 100 Plus
e(y)2b-RA 559 CG14612-RA 86..374 16..304 1445 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 16:37:10
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7094263..7094402 94..233 700 100 Plus
3R 32079331 3R 7094123..7094200 16..93 390 100 Plus
3R 32079331 3R 7094471..7094542 233..304 360 100 Plus
Blast to na_te.dros performed on 2015-02-11 16:37:13 has no hits.

BS17182.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:04:58 Download gff for BS17182.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14612-PA 1..288 17..304 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 19:51:02 Download gff for BS17182.5prime
Subject Subject Range Query Range Percent Splice Strand
e(y)2b-RA 80..374 12..304 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:41:53 Download gff for BS17182.5prime
Subject Subject Range Query Range Percent Splice Strand
e(y)2b-RA 80..374 12..304 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:41:53 Download gff for BS17182.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 7094117..7094200 12..93 97 -> Plus
3R 7094263..7094401 94..232 100 -> Plus
3R 7094471..7094542 233..304 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 19:51:02 Download gff for BS17182.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2919839..2919922 12..93 97 -> Plus
arm_3R 2919985..2920123 94..232 100 -> Plus
arm_3R 2920193..2920264 233..304 100   Plus

BS17182.complete Sequence

320 bp assembled on 2007-05-08

GenBank Submission: FJ638268

> BS17182.complete
GAAGTTATCAGTCGACATGACAATAAACAAGGAAACGGGAACCGATCCCG
ATCCTGGATATAAGCCTACGTTACGCAGTCAAGATAAGGCCGCCCTGAAG
GAACTGCTGCACACGCGTCTTGTGGAGTGCGGATGGCACAAGGACATTAA
GGAAATGATACGAAACATCATCATGGAGCGCGGAGTGGACAATATAAACC
GCGACCAACTGGCTGCCCAAATAGTCCCGCAAGCTCGCGCTTTGGTGCCT
GAAGTCGTCAAAAATGAGATGATGCTGCGCGTGCACGCCGCCCTCGATAA
GTAGAAGCTTTCTAGACCAT

BS17182.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:38:38
Subject Length Description Subject Range Query Range Score Percent Strand
e(y)2b-RB 288 CG14612-PB 1..288 17..304 1440 100 Plus
e(y)2b-RA 288 CG14612-PA 1..288 17..304 1440 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:38:40
Subject Length Description Subject Range Query Range Score Percent Strand
e(y)2b-RB 662 CG14612-RB 189..477 16..304 1445 100 Plus
e(y)2b-RA 559 CG14612-RA 86..374 16..304 1445 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:38:37
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7094263..7094402 94..233 700 100 Plus
3R 32079331 3R 7094123..7094200 16..93 390 100 Plus
3R 32079331 3R 7094471..7094542 233..304 360 100 Plus
Blast to na_te.dros performed on 2014-11-27 13:38:38 has no hits.

BS17182.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:13:51 Download gff for BS17182.complete
Subject Subject Range Query Range Percent Splice Strand
CG14612-RA 1..288 17..304 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:14:33 Download gff for BS17182.complete
Subject Subject Range Query Range Percent Splice Strand
CG14612-RA 1..288 17..304 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:20:57 Download gff for BS17182.complete
Subject Subject Range Query Range Percent Splice Strand
e(y)2b-RA 87..374 17..304 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:13:51 Download gff for BS17182.complete
Subject Subject Range Query Range Percent Splice Strand
CG14612-RA 1..288 17..304 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:52:36 Download gff for BS17182.complete
Subject Subject Range Query Range Percent Splice Strand
e(y)2b-RA 87..374 17..304 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:52:36 Download gff for BS17182.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7094263..7094401 94..232 100 -> Plus
3R 7094471..7094542 233..304 100   Plus
3R 7094124..7094200 17..93 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:20:57 Download gff for BS17182.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2920193..2920264 233..304 100   Plus
arm_3R 2919985..2920123 94..232 100 -> Plus
arm_3R 2919846..2919922 17..93 100 -> Plus

BS17182.pep Sequence

Translation from 16 to 303

> BS17182.pep
MTINKETGTDPDPGYKPTLRSQDKAALKELLHTRLVECGWHKDIKEMIRN
IIMERGVDNINRDQLAAQIVPQARALVPEVVKNEMMLRVHAALDK*

BS17182.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:41:18
Subject Length Description Subject Range Query Range Score Percent Strand
e(y)2b-PB 95 CG14612-PB 1..95 1..95 490 100 Plus
e(y)2b-PA 95 CG14612-PA 1..95 1..95 490 100 Plus
e(y)2-PA 101 CG15191-PA 11..87 18..93 181 41.6 Plus