Clone Sequence Records
BS17182.3prime Sequence
318 bp (318 high quality bases) assembled on 2007-05-15
> BS17182.3prime
ATGGTCTAGAAAGCTTCTACTTATCGAGGGCGGCGTGCACGCGCAGCATC
ATCTCATTTTTGACGACTTCAGGCACCAAAGCGCGAGCTTGCGGGACTAT
TTGGGCAGCCAGTTGGTCGCGGTTTATATTGTCCACTCCGCGCTCCATGA
TGATGTTTCGTATCATTTCCTTAATGTCCTTGTGCCATCCGCACTCCACA
AGACGCGTGTGCAGCAGTTCCTTCAGGGCGGCCTTATCTTGACTGCGTAA
CGTAGGCTTATATCCAGGATCGGGATCGGTTCCCGTTTCCTTGTTTATTG
TCATGTCGACTGATAACT
BS17182.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:09:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14612-PA | 288 | CG14612-RA | 1..288 | 304..17 | 1440 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:38:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
e(y)2b-RB | 662 | CG14612-RB | 189..477 | 305..17 | 1445 | 100 | Minus |
e(y)2b-RA | 559 | CG14612-RA | 86..374 | 305..17 | 1445 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:38:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 7094263..7094402 | 227..88 | 700 | 100 | Minus |
3R | 32079331 | 3R | 7094123..7094200 | 305..228 | 390 | 100 | Minus |
3R | 32079331 | 3R | 7094471..7094542 | 88..17 | 360 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-10 21:38:12 has no hits.
BS17182.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:09:13 Download gff for
BS17182.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14612-PA | 1..288 | 17..304 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 11:15:39 Download gff for
BS17182.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
e(y)2b-RA | 80..374 | 17..309 | 99 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 00:00:12 Download gff for
BS17182.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
e(y)2b-RA | 80..374 | 17..309 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 00:00:12 Download gff for
BS17182.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 7094117..7094200 | 228..309 | 97 | -> | Minus |
3R | 7094263..7094401 | 89..227 | 100 | -> | Minus |
3R | 7094471..7094542 | 17..88 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 11:15:39 Download gff for
BS17182.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 2919839..2919922 | 228..309 | 97 | -> | Minus |
arm_3R | 2919985..2920123 | 89..227 | 100 | -> | Minus |
arm_3R | 2920193..2920264 | 17..88 | 100 | | Minus |
BS17182.5prime Sequence
318 bp (318 high quality bases) assembled on 2007-05-15
> BS17182.5prime
GAAGTTATCAGTCGACATGACAATAAACAAGGAAACGGGAACCGATCCCG
ATCCTGGATATAAGCCTACGTTACGCAGTCAAGATAAGGCCGCCCTGAAG
GAACTGCTGCACACGCGTCTTGTGGAGTGCGGATGGCACAAGGACATTAA
GGAAATGATACGAAACATCATCATGGAGCGCGGAGTGGACAATATAAACC
GCGACCAACTGGCTGCCCAAATAGTCCCGCAAGCTCGCGCTTTGGTGCCT
GAAGTCGTCAAAAATGAGATGATGCTGCGCGTGCACGCCGCCCTCGATAA
GTAGAAGCTTTCTAGACC
BS17182.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:04:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14612-PA | 288 | CG14612-RA | 1..288 | 17..304 | 1440 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 16:37:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
e(y)2b-RB | 662 | CG14612-RB | 189..477 | 16..304 | 1445 | 100 | Plus |
e(y)2b-RA | 559 | CG14612-RA | 86..374 | 16..304 | 1445 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 16:37:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 7094263..7094402 | 94..233 | 700 | 100 | Plus |
3R | 32079331 | 3R | 7094123..7094200 | 16..93 | 390 | 100 | Plus |
3R | 32079331 | 3R | 7094471..7094542 | 233..304 | 360 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-11 16:37:13 has no hits.
BS17182.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:04:58 Download gff for
BS17182.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14612-PA | 1..288 | 17..304 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 19:51:02 Download gff for
BS17182.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
e(y)2b-RA | 80..374 | 12..304 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:41:53 Download gff for
BS17182.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
e(y)2b-RA | 80..374 | 12..304 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:41:53 Download gff for
BS17182.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 7094117..7094200 | 12..93 | 97 | -> | Plus |
3R | 7094263..7094401 | 94..232 | 100 | -> | Plus |
3R | 7094471..7094542 | 233..304 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 19:51:02 Download gff for
BS17182.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 2919839..2919922 | 12..93 | 97 | -> | Plus |
arm_3R | 2919985..2920123 | 94..232 | 100 | -> | Plus |
arm_3R | 2920193..2920264 | 233..304 | 100 | | Plus |
BS17182.complete Sequence
320 bp assembled on 2007-05-08
GenBank Submission: FJ638268
> BS17182.complete
GAAGTTATCAGTCGACATGACAATAAACAAGGAAACGGGAACCGATCCCG
ATCCTGGATATAAGCCTACGTTACGCAGTCAAGATAAGGCCGCCCTGAAG
GAACTGCTGCACACGCGTCTTGTGGAGTGCGGATGGCACAAGGACATTAA
GGAAATGATACGAAACATCATCATGGAGCGCGGAGTGGACAATATAAACC
GCGACCAACTGGCTGCCCAAATAGTCCCGCAAGCTCGCGCTTTGGTGCCT
GAAGTCGTCAAAAATGAGATGATGCTGCGCGTGCACGCCGCCCTCGATAA
GTAGAAGCTTTCTAGACCAT
BS17182.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:38:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
e(y)2b-RB | 288 | CG14612-PB | 1..288 | 17..304 | 1440 | 100 | Plus |
e(y)2b-RA | 288 | CG14612-PA | 1..288 | 17..304 | 1440 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:38:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
e(y)2b-RB | 662 | CG14612-RB | 189..477 | 16..304 | 1445 | 100 | Plus |
e(y)2b-RA | 559 | CG14612-RA | 86..374 | 16..304 | 1445 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:38:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 7094263..7094402 | 94..233 | 700 | 100 | Plus |
3R | 32079331 | 3R | 7094123..7094200 | 16..93 | 390 | 100 | Plus |
3R | 32079331 | 3R | 7094471..7094542 | 233..304 | 360 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 13:38:38 has no hits.
BS17182.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:13:51 Download gff for
BS17182.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14612-RA | 1..288 | 17..304 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:14:33 Download gff for
BS17182.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14612-RA | 1..288 | 17..304 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:20:57 Download gff for
BS17182.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
e(y)2b-RA | 87..374 | 17..304 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:13:51 Download gff for
BS17182.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14612-RA | 1..288 | 17..304 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:52:36 Download gff for
BS17182.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
e(y)2b-RA | 87..374 | 17..304 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:52:36 Download gff for
BS17182.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 7094263..7094401 | 94..232 | 100 | -> | Plus |
3R | 7094471..7094542 | 233..304 | 100 | | Plus |
3R | 7094124..7094200 | 17..93 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:20:57 Download gff for
BS17182.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 2920193..2920264 | 233..304 | 100 | | Plus |
arm_3R | 2919985..2920123 | 94..232 | 100 | -> | Plus |
arm_3R | 2919846..2919922 | 17..93 | 100 | -> | Plus |
BS17182.pep Sequence
Translation from 16 to 303
> BS17182.pep
MTINKETGTDPDPGYKPTLRSQDKAALKELLHTRLVECGWHKDIKEMIRN
IIMERGVDNINRDQLAAQIVPQARALVPEVVKNEMMLRVHAALDK*
BS17182.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:41:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
e(y)2b-PB | 95 | CG14612-PB | 1..95 | 1..95 | 490 | 100 | Plus |
e(y)2b-PA | 95 | CG14612-PA | 1..95 | 1..95 | 490 | 100 | Plus |
e(y)2-PA | 101 | CG15191-PA | 11..87 | 18..93 | 181 | 41.6 | Plus |