Clone BS17184 Report

Search the DGRC for BS17184

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:171
Well:84
Vector:pDNR-Dual
Associated Gene/TranscriptCG13018-RA
Protein status:BS17184.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS17184.3prime Sequence

270 bp (270 high quality bases) assembled on 2007-05-15

> BS17184.3prime
ATGGTCTAGAAAGCTTTCCTTAGCCCTTGCGACCTCGAAAGCGCTGTCGG
TTGTCCAACAGGGAGCGCTTGCACTCGTAGAAGGTATTGCGGACCACCTG
GCACTCAGCTGGAACGTTGTTGTCCTGGAGGCACTGGCGCGGCGTTTTGC
CCATTTTGCAGCAGTCGCTCTCCAGGAGGCACATCTTGAGATCCGCACGT
ACTCCCGCGCACGCTGTCTCATCGGCCAGCCTCTCGTTGCCCTCGTAGCG
CATCATGTCGACTGATAACT

BS17184.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:09:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG13018-PA 240 CG13018-RA 1..236 256..21 1155 99.5 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 06:09:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG13018-RA 379 CG13018-RA 85..320 256..21 1165 99.6 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 06:09:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14157203..14157404 55..256 980 99 Plus
2R 25286936 2R 14157109..14157147 21..59 195 100 Plus
Blast to na_te.dros performed 2015-02-13 06:09:50
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy11 4428 gypsy11 GYPSY11 4428bp 1052..1077 52..27 103 88.5 Minus

BS17184.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:09:31 Download gff for BS17184.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13018-PA 1..240 17..256 98   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 18:51:03 Download gff for BS17184.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13018-RA 76..324 17..264 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 08:11:13 Download gff for BS17184.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13018-RA 76..324 17..264 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 08:11:13 Download gff for BS17184.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 14157105..14157146 17..58 95 <- Plus
2R 14157207..14157413 59..264 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 18:51:03 Download gff for BS17184.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10044610..10044651 17..58 95 <- Plus
arm_2R 10044712..10044918 59..264 97   Plus

BS17184.5prime Sequence

270 bp (270 high quality bases) assembled on 2007-05-15

> BS17184.5prime
GAAGTTATCAGTCGACATGATGCGCTACGAGGGCAACGAGAGGCTGGCCG
ATGAGACAGCGTGCGCGGGAGTACGTGCGGATCTCAAGATGTGCCTCCTG
GAGAGCGACTGCTGCAAAATGGGCAAAACGCCGCGCCAGTGCCTCCAGGA
CAACAACGTTCCAGCTGAGTGCCAGGTGCTCCGCAATACCTTCTACGAGT
GCAAGCGCTCCCTGTTGGACAACCGACAGCGCTTTCGAGGTCGCAAGGGC
TACTGAAAGCTTTCTAGACC

BS17184.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:05:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG13018-PA 240 CG13018-RA 1..240 17..256 1200 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 16:38:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG13018-RA 379 CG13018-RA 85..324 17..256 1200 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 16:38:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14157203..14157404 218..17 995 99.5 Minus
2R 25286936 2R 14157105..14157147 256..214 215 100 Minus
Blast to na_te.dros performed 2015-02-11 16:38:21
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy11 4428 gypsy11 GYPSY11 4428bp 1052..1077 221..246 103 88.5 Plus

BS17184.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:05:15 Download gff for BS17184.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13018-PA 1..240 17..256 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 19:51:09 Download gff for BS17184.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13018-RA 76..333 9..269 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:44:14 Download gff for BS17184.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13018-RA 76..333 9..269 96   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:44:14 Download gff for BS17184.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 14157207..14157413 9..214 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 19:51:09 Download gff for BS17184.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10044712..10044918 9..214 98   Minus

BS17184.complete Sequence

272 bp assembled on 2007-05-08

GenBank Submission: FJ638270

> BS17184.complete
GAAGTTATCAGTCGACATGATGCGCTACGAGGGCAACGAGAGGCTGGCCG
ATGAGACAGCGTGCGCGGGAGTACGTGCGGATCTCAAGATGTGCCTCCTG
GAGAGCGACTGCTGCAAAATGGGCAAAACGCCGCGCCAGTGCCTCCAGGA
CAACAACGTTCCAGCTGAGTGCCAGGTGCTCCGCAATACCTTCTACGAGT
GCAAGCGCTCCCTGTTGGACAACCGACAGCGCTTTCGAGGTCGCAAGGGC
TACTGAAAGCTTTCTAGACCAT

BS17184.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:42:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG13018-RA 240 CG13018-PA 1..240 17..256 1200 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:42:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG13018-RA 379 CG13018-RA 85..324 17..256 1200 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:41:59
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14157203..14157404 218..17 995 99.5 Minus
2R 25286936 2R 14157105..14157147 256..214 215 100 Minus
Blast to na_te.dros performed 2014-11-27 15:42:00
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy11 4428 gypsy11 GYPSY11 4428bp 1052..1077 221..246 103 88.5 Plus

BS17184.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:45:13 Download gff for BS17184.complete
Subject Subject Range Query Range Percent Splice Strand
CG13018-RA 1..240 17..256 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:12:06 Download gff for BS17184.complete
Subject Subject Range Query Range Percent Splice Strand
CG13018-RA 1..240 17..256 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:44:54 Download gff for BS17184.complete
Subject Subject Range Query Range Percent Splice Strand
CG13018-RA 85..323 17..255 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:45:13 Download gff for BS17184.complete
Subject Subject Range Query Range Percent Splice Strand
CG13018-RA 1..240 17..256 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:14:16 Download gff for BS17184.complete
Subject Subject Range Query Range Percent Splice Strand
CG13018-RA 85..323 17..255 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:14:16 Download gff for BS17184.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14157106..14157146 215..255 100 <- Minus
2R 14157207..14157404 17..214 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:44:54 Download gff for BS17184.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10044611..10044651 215..255 100 <- Minus
arm_2R 10044712..10044909 17..214 100   Minus

BS17184.pep Sequence

Translation from 16 to 255

> BS17184.pep
MMRYEGNERLADETACAGVRADLKMCLLESDCCKMGKTPRQCLQDNNVPA
ECQVLRNTFYECKRSLLDNRQRFRGRKGY*

BS17184.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:35:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG13018-PA 79 CG13018-PA 1..79 1..79 432 100 Plus