Clone Sequence Records
BS17184.3prime Sequence
270 bp (270 high quality bases) assembled on 2007-05-15
> BS17184.3prime
ATGGTCTAGAAAGCTTTCCTTAGCCCTTGCGACCTCGAAAGCGCTGTCGG
TTGTCCAACAGGGAGCGCTTGCACTCGTAGAAGGTATTGCGGACCACCTG
GCACTCAGCTGGAACGTTGTTGTCCTGGAGGCACTGGCGCGGCGTTTTGC
CCATTTTGCAGCAGTCGCTCTCCAGGAGGCACATCTTGAGATCCGCACGT
ACTCCCGCGCACGCTGTCTCATCGGCCAGCCTCTCGTTGCCCTCGTAGCG
CATCATGTCGACTGATAACT
BS17184.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:09:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13018-PA | 240 | CG13018-RA | 1..236 | 256..21 | 1155 | 99.5 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 06:09:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13018-RA | 379 | CG13018-RA | 85..320 | 256..21 | 1165 | 99.6 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 06:09:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 14157203..14157404 | 55..256 | 980 | 99 | Plus |
2R | 25286936 | 2R | 14157109..14157147 | 21..59 | 195 | 100 | Plus |
Blast to na_te.dros performed 2015-02-13 06:09:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
gypsy11 | 4428 | gypsy11 GYPSY11 4428bp | 1052..1077 | 52..27 | 103 | 88.5 | Minus |
BS17184.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:09:31 Download gff for
BS17184.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13018-PA | 1..240 | 17..256 | 98 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 18:51:03 Download gff for
BS17184.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13018-RA | 76..324 | 17..264 | 97 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 08:11:13 Download gff for
BS17184.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13018-RA | 76..324 | 17..264 | 97 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 08:11:13 Download gff for
BS17184.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 14157105..14157146 | 17..58 | 95 | <- | Plus |
2R | 14157207..14157413 | 59..264 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 18:51:03 Download gff for
BS17184.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 10044610..10044651 | 17..58 | 95 | <- | Plus |
arm_2R | 10044712..10044918 | 59..264 | 97 | | Plus |
BS17184.5prime Sequence
270 bp (270 high quality bases) assembled on 2007-05-15
> BS17184.5prime
GAAGTTATCAGTCGACATGATGCGCTACGAGGGCAACGAGAGGCTGGCCG
ATGAGACAGCGTGCGCGGGAGTACGTGCGGATCTCAAGATGTGCCTCCTG
GAGAGCGACTGCTGCAAAATGGGCAAAACGCCGCGCCAGTGCCTCCAGGA
CAACAACGTTCCAGCTGAGTGCCAGGTGCTCCGCAATACCTTCTACGAGT
GCAAGCGCTCCCTGTTGGACAACCGACAGCGCTTTCGAGGTCGCAAGGGC
TACTGAAAGCTTTCTAGACC
BS17184.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:05:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13018-PA | 240 | CG13018-RA | 1..240 | 17..256 | 1200 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 16:38:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13018-RA | 379 | CG13018-RA | 85..324 | 17..256 | 1200 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 16:38:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 14157203..14157404 | 218..17 | 995 | 99.5 | Minus |
2R | 25286936 | 2R | 14157105..14157147 | 256..214 | 215 | 100 | Minus |
Blast to na_te.dros performed 2015-02-11 16:38:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
gypsy11 | 4428 | gypsy11 GYPSY11 4428bp | 1052..1077 | 221..246 | 103 | 88.5 | Plus |
BS17184.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:05:15 Download gff for
BS17184.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13018-PA | 1..240 | 17..256 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 19:51:09 Download gff for
BS17184.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13018-RA | 76..333 | 9..269 | 96 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:44:14 Download gff for
BS17184.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13018-RA | 76..333 | 9..269 | 96 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:44:14 Download gff for
BS17184.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 14157207..14157413 | 9..214 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 19:51:09 Download gff for
BS17184.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 10044712..10044918 | 9..214 | 98 | | Minus |
BS17184.complete Sequence
272 bp assembled on 2007-05-08
GenBank Submission: FJ638270
> BS17184.complete
GAAGTTATCAGTCGACATGATGCGCTACGAGGGCAACGAGAGGCTGGCCG
ATGAGACAGCGTGCGCGGGAGTACGTGCGGATCTCAAGATGTGCCTCCTG
GAGAGCGACTGCTGCAAAATGGGCAAAACGCCGCGCCAGTGCCTCCAGGA
CAACAACGTTCCAGCTGAGTGCCAGGTGCTCCGCAATACCTTCTACGAGT
GCAAGCGCTCCCTGTTGGACAACCGACAGCGCTTTCGAGGTCGCAAGGGC
TACTGAAAGCTTTCTAGACCAT
BS17184.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:42:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13018-RA | 240 | CG13018-PA | 1..240 | 17..256 | 1200 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:42:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13018-RA | 379 | CG13018-RA | 85..324 | 17..256 | 1200 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:41:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 14157203..14157404 | 218..17 | 995 | 99.5 | Minus |
2R | 25286936 | 2R | 14157105..14157147 | 256..214 | 215 | 100 | Minus |
Blast to na_te.dros performed 2014-11-27 15:42:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
gypsy11 | 4428 | gypsy11 GYPSY11 4428bp | 1052..1077 | 221..246 | 103 | 88.5 | Plus |
BS17184.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:45:13 Download gff for
BS17184.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13018-RA | 1..240 | 17..256 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:12:06 Download gff for
BS17184.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13018-RA | 1..240 | 17..256 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:44:54 Download gff for
BS17184.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13018-RA | 85..323 | 17..255 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:45:13 Download gff for
BS17184.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13018-RA | 1..240 | 17..256 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:14:16 Download gff for
BS17184.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13018-RA | 85..323 | 17..255 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:14:16 Download gff for
BS17184.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 14157106..14157146 | 215..255 | 100 | <- | Minus |
2R | 14157207..14157404 | 17..214 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:44:54 Download gff for
BS17184.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 10044611..10044651 | 215..255 | 100 | <- | Minus |
arm_2R | 10044712..10044909 | 17..214 | 100 | | Minus |
BS17184.pep Sequence
Translation from 16 to 255
> BS17184.pep
MMRYEGNERLADETACAGVRADLKMCLLESDCCKMGKTPRQCLQDNNVPA
ECQVLRNTFYECKRSLLDNRQRFRGRKGY*
BS17184.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:35:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13018-PA | 79 | CG13018-PA | 1..79 | 1..79 | 432 | 100 | Plus |