Clone BS17187 Report

Search the DGRC for BS17187

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:171
Well:87
Vector:pDNR-Dual
Associated Gene/TranscriptCG14483-RA
Protein status:BS17187.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS17187.3prime Sequence

279 bp (279 high quality bases) assembled on 2007-05-15

> BS17187.3prime
ATGGTCTAGAAAGCTTCTACTTCTTCTGCTTGCCCTCCGCCTCCTCCATA
GCACGCATCATTTTGGCGTCGTGCTGGGCGTGGTGTTCACGGATTGCCCG
CTGCAGCTCCTCGTGGTGGCTTTTGCTTTCCGGCGGATAAAGTTCCCGCT
TCTTCTTGGTCACCCATTCTTCAAAGTATTCCGGCTGGTTAAACAAGTGG
AATAGCGTCACCGGAAAGGCCATGTACATGCCCATCTTGGCCACCTCCAG
CACCCAGGTTCCCATGTCGACTGATAACT

BS17187.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:07:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG14483-PA 249 CG14483-RA 1..249 265..17 1245 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 16:07:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG14483-RC 955 CG14483-RC 108..361 269..16 1255 99.6 Minus
CG14483-RB 437 CG14483-RB 30..283 269..16 1255 99.6 Minus
CG14483-RA 515 CG14483-RA 108..361 269..16 1255 99.6 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 16:07:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17585789..17586042 16..269 1255 99.6 Plus
Blast to na_te.dros performed on 2015-02-12 16:07:46 has no hits.

BS17187.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:07:42 Download gff for BS17187.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14483-PA 1..249 17..265 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 15:20:52 Download gff for BS17187.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14483-RA 101..367 9..279 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 18:43:27 Download gff for BS17187.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14483-RA 101..367 9..279 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 18:43:27 Download gff for BS17187.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 17585783..17586049 9..279 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 15:20:52 Download gff for BS17187.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13473288..13473554 9..279 97   Plus

BS17187.complete Sequence

281 bp assembled on 2007-05-08

GenBank Submission: FJ638273

> BS17187.complete
GAAGTTATCAGTCGACATGGGAACCTGGGTGCTGGAGGTGGCCAAGATGG
GCATGTACATGGCCTTTCCGGTGACGCTATTCCACTTGTTTAACCAGCCG
GAATACTTTGAAGAATGGGTGACCAAGAAGAAGCGGGAACTTTATCCGCC
GGAAAGCAAAAGCCACCACGAGGAGCTGCAGCGGGCAATCCGTGAACACC
ACGCCCAGCACGACGCCAAAATGATGCGTGCTATGGAGGAGGCGGAGGGC
AAGCAGAAGAAGTAGAAGCTTTCTAGACCAT

BS17187.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:26:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG14483-RC 249 CG14483-PC 1..249 17..265 1245 100 Plus
CG14483-RB 249 CG14483-PB 1..249 17..265 1245 100 Plus
CG14483-RA 249 CG14483-PA 1..249 17..265 1245 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:26:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG14483-RC 955 CG14483-RC 108..361 13..266 1255 99.6 Plus
CG14483-RB 437 CG14483-RB 30..283 13..266 1255 99.6 Plus
CG14483-RA 515 CG14483-RA 108..361 13..266 1255 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:26:56
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17585789..17586042 266..13 1255 99.6 Minus
Blast to na_te.dros performed on 2014-11-27 08:26:57 has no hits.

BS17187.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:45:20 Download gff for BS17187.complete
Subject Subject Range Query Range Percent Splice Strand
CG14483-RA 1..249 17..265 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:12:14 Download gff for BS17187.complete
Subject Subject Range Query Range Percent Splice Strand
CG14483-RA 43..308 5..273 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:10:38 Download gff for BS17187.complete
Subject Subject Range Query Range Percent Splice Strand
CG14483-RA 112..360 17..265 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:45:21 Download gff for BS17187.complete
Subject Subject Range Query Range Percent Splice Strand
CG14483-RA 43..308 5..273 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:19:01 Download gff for BS17187.complete
Subject Subject Range Query Range Percent Splice Strand
CG14483-RA 112..360 17..265 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:19:01 Download gff for BS17187.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17585790..17586038 17..265 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:10:38 Download gff for BS17187.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13473295..13473543 17..265 100   Minus

BS17187.5prime Sequence

279 bp (279 high quality bases) assembled on 2007-05-15

> BS17187.5prime
GAAGTTATCAGTCGACATGGGAACCTGGGTGCTGGAGGTGGCCAAGATGG
GCATGTACATGGCCTTTCCGGTGACGCTATTCCACTTGTTTAACCAGCCG
GAATACTTTGAAGAATGGGTGACCAAGAAGAAGCGGGAACTTTATCCGCC
GGAAAGCAAAAGCCACCACGAGGAGCTGCAGCGGGCAATCCGTGAACACC
ACGCCCAGCACGACGCCAAAATGATGCGTGCTATGGAGGAGGCGGAGGGC
AAGCAGAAGAAGTAGAAGCTTTCTAGACC

BS17187.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:03:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG14483-PA 249 CG14483-RA 1..249 17..265 1245 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 06:57:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG14483-RC 955 CG14483-RC 108..361 13..266 1255 99.6 Plus
CG14483-RB 437 CG14483-RB 30..283 13..266 1255 99.6 Plus
CG14483-RA 515 CG14483-RA 108..361 13..266 1255 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 06:57:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17585789..17586042 266..13 1255 99.6 Minus
Blast to na_te.dros performed on 2015-02-13 06:57:18 has no hits.

BS17187.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:03:31 Download gff for BS17187.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14483-PA 1..249 17..265 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 20:25:02 Download gff for BS17187.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14483-RA 102..367 5..273 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 09:24:36 Download gff for BS17187.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14483-RA 102..367 5..273 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 09:24:36 Download gff for BS17187.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 17585783..17586048 5..273 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 20:25:02 Download gff for BS17187.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13473288..13473553 5..273 97   Minus

BS17187.pep Sequence

Translation from 16 to 264

> BS17187.pep
MGTWVLEVAKMGMYMAFPVTLFHLFNQPEYFEEWVTKKKRELYPPESKSH
HEELQRAIREHHAQHDAKMMRAMEEAEGKQKK*

BS17187.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:34:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG14483-PC 82 CG14483-PC 1..82 1..82 444 100 Plus
CG14483-PB 82 CG14483-PB 1..82 1..82 444 100 Plus
CG14483-PA 82 CG14483-PA 1..82 1..82 444 100 Plus