Clone BS17188 Report

Search the DGRC for BS17188

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:171
Well:88
Vector:pDNR-Dual
Associated Gene/TranscriptCG14701-RA
Protein status:BS17188.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS17188.3prime Sequence

291 bp (291 high quality bases) assembled on 2007-05-15

> BS17188.3prime
ATGGTCTAGAAAGCTTTTAGTTCTTCTCGAGCTTCAGGTCGCCGAGCTTC
TCGTTCAGCGCACTTTCTTCATCCTCCTCAGCTTTGAACATCTCCGGATC
GTATATGACCTTGATGACTAGGGAGCAGCTGGGACAGGTGGCCACCTCCT
CGCCCTCGATTAGCTCCTCCTTGGAGATCTGAAATCGATCGCCGCATGGA
CAGGGATAGTAGTACATCTCCTCCTCCTCGTCGTACTCGAAGTCCTCGAT
CTCCACCTCGTCGTGATAGATGCTCATGTCGACTGATAACT

BS17188.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:09:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG14701-PA 261 CG14701-RA 1..261 277..17 1305 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 16:13:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG14701-RA 487 CG14701-RA 105..366 278..17 1310 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 16:13:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11232016..11232125 278..169 550 100 Minus
3R 32079331 3R 11232340..11232418 95..17 395 100 Minus
3R 32079331 3R 11232192..11232269 171..94 390 100 Minus
Blast to na_te.dros performed on 2015-02-12 16:13:43 has no hits.

BS17188.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:09:35 Download gff for BS17188.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14701-PA 1..261 17..277 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 15:21:08 Download gff for BS17188.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14701-RA 102..366 17..281 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 18:27:25 Download gff for BS17188.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14701-RA 102..366 17..281 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 18:27:25 Download gff for BS17188.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 11232341..11232424 15..94 95 -> Minus
3R 11232013..11232124 170..281 99 -> Minus
3R 11232194..11232268 95..169 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 15:21:08 Download gff for BS17188.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7057735..7057846 170..281 99 -> Minus
arm_3R 7057916..7057990 95..169 100 -> Minus
arm_3R 7058063..7058146 15..94 95 -> Minus

BS17188.5prime Sequence

291 bp (291 high quality bases) assembled on 2007-05-15

> BS17188.5prime
GAAGTTATCAGTCGACATGAGCATCTATCACGACGAGGTGGAGATCGAGG
ACTTCGAGTACGACGAGGAGGAGGAGATGTACTACTATCCCTGTCCATGC
GGCGATCGATTTCAGATCTCCAAGGAGGAGCTAATCGAGGGCGAGGAGGT
GGCCACCTGTCCCAGCTGCTCCCTAGTCATCAAGGTCATATACGATCCGG
AGATGTTCAAAGCTGAGGAGGATGAAGAAAGTGCGCTGAACGAGAAGCTC
GGCGACCTGAAGCTCGAGAAGAACTAAAAGCTTTCTAGACC

BS17188.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:05:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG14701-PA 261 CG14701-RA 1..261 17..277 1305 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 06:57:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG14701-RA 487 CG14701-RA 105..366 16..277 1310 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 06:57:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11232016..11232125 16..125 550 100 Plus
3R 32079331 3R 11232340..11232418 199..277 395 100 Plus
3R 32079331 3R 11232192..11232269 123..200 390 100 Plus
Blast to na_te.dros performed on 2015-02-13 06:57:51 has no hits.

BS17188.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:05:19 Download gff for BS17188.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14701-PA 1..261 17..277 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 20:47:14 Download gff for BS17188.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14701-RA 102..366 13..277 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 09:26:25 Download gff for BS17188.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14701-RA 102..366 13..277 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 09:26:25 Download gff for BS17188.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 11232013..11232124 13..124 99 -> Plus
3R 11232194..11232268 125..199 100 -> Plus
3R 11232341..11232418 200..277 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 20:47:14 Download gff for BS17188.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7057735..7057846 13..124 99 -> Plus
arm_3R 7057916..7057990 125..199 100 -> Plus
arm_3R 7058063..7058140 200..277 100   Plus

BS17188.complete Sequence

293 bp assembled on 2007-05-08

GenBank Submission: FJ638274

> BS17188.complete
GAAGTTATCAGTCGACATGAGCATCTATCACGACGAGGTGGAGATCGAGG
ACTTCGAGTACGACGAGGAGGAGGAGATGTACTACTATCCCTGTCCATGC
GGCGATCGATTTCAGATCTCCAAGGAGGAGCTAATCGAGGGCGAGGAGGT
GGCCACCTGTCCCAGCTGCTCCCTAGTCATCAAGGTCATATACGATCCGG
AGATGTTCAAAGCTGAGGAGGATGAAGAAAGTGCGCTGAACGAGAAGCTC
GGCGACCTGAAGCTCGAGAAGAACTAAAAGCTTTCTAGACCAT

BS17188.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:01:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG14701-RA 261 CG14701-PA 1..261 17..277 1305 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:01:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG14701-RA 487 CG14701-RA 105..366 16..277 1310 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:01:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11232016..11232125 16..125 550 100 Plus
3R 32079331 3R 11232340..11232418 199..277 395 100 Plus
3R 32079331 3R 11232192..11232269 123..200 390 100 Plus
Blast to na_te.dros performed on 2014-11-28 08:01:31 has no hits.

BS17188.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:45:56 Download gff for BS17188.complete
Subject Subject Range Query Range Percent Splice Strand
CG14701-RA 1..261 17..277 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:38:28 Download gff for BS17188.complete
Subject Subject Range Query Range Percent Splice Strand
CG14701-RA 1..259 17..275 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:12:44 Download gff for BS17188.complete
Subject Subject Range Query Range Percent Splice Strand
CG14701-RA 106..364 17..275 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:45:58 Download gff for BS17188.complete
Subject Subject Range Query Range Percent Splice Strand
CG14701-RA 1..261 17..277 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:09:19 Download gff for BS17188.complete
Subject Subject Range Query Range Percent Splice Strand
CG14701-RA 106..364 17..275 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:09:19 Download gff for BS17188.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11232017..11232124 17..124 100 -> Plus
3R 11232194..11232268 125..199 100 -> Plus
3R 11232341..11232416 200..275 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:12:44 Download gff for BS17188.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7057739..7057846 17..124 100 -> Plus
arm_3R 7057916..7057990 125..199 100 -> Plus
arm_3R 7058063..7058138 200..275 100   Plus

BS17188.pep Sequence

Translation from 16 to 276

> BS17188.pep
MSIYHDEVEIEDFEYDEEEEMYYYPCPCGDRFQISKEELIEGEEVATCPS
CSLVIKVIYDPEMFKAEEDEESALNEKLGDLKLEKN*

BS17188.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:25:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG14701-PA 86 CG14701-PA 1..86 1..86 460 100 Plus