Clone Sequence Records
BS17188.3prime Sequence
291 bp (291 high quality bases) assembled on 2007-05-15
> BS17188.3prime
ATGGTCTAGAAAGCTTTTAGTTCTTCTCGAGCTTCAGGTCGCCGAGCTTC
TCGTTCAGCGCACTTTCTTCATCCTCCTCAGCTTTGAACATCTCCGGATC
GTATATGACCTTGATGACTAGGGAGCAGCTGGGACAGGTGGCCACCTCCT
CGCCCTCGATTAGCTCCTCCTTGGAGATCTGAAATCGATCGCCGCATGGA
CAGGGATAGTAGTACATCTCCTCCTCCTCGTCGTACTCGAAGTCCTCGAT
CTCCACCTCGTCGTGATAGATGCTCATGTCGACTGATAACT
BS17188.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:09:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14701-PA | 261 | CG14701-RA | 1..261 | 277..17 | 1305 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 16:13:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14701-RA | 487 | CG14701-RA | 105..366 | 278..17 | 1310 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 16:13:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 11232016..11232125 | 278..169 | 550 | 100 | Minus |
3R | 32079331 | 3R | 11232340..11232418 | 95..17 | 395 | 100 | Minus |
3R | 32079331 | 3R | 11232192..11232269 | 171..94 | 390 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-12 16:13:43 has no hits.
BS17188.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:09:35 Download gff for
BS17188.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14701-PA | 1..261 | 17..277 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 15:21:08 Download gff for
BS17188.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14701-RA | 102..366 | 17..281 | 99 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 18:27:25 Download gff for
BS17188.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14701-RA | 102..366 | 17..281 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 18:27:25 Download gff for
BS17188.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 11232341..11232424 | 15..94 | 95 | -> | Minus |
3R | 11232013..11232124 | 170..281 | 99 | -> | Minus |
3R | 11232194..11232268 | 95..169 | 100 | -> | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 15:21:08 Download gff for
BS17188.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 7057735..7057846 | 170..281 | 99 | -> | Minus |
arm_3R | 7057916..7057990 | 95..169 | 100 | -> | Minus |
arm_3R | 7058063..7058146 | 15..94 | 95 | -> | Minus |
BS17188.5prime Sequence
291 bp (291 high quality bases) assembled on 2007-05-15
> BS17188.5prime
GAAGTTATCAGTCGACATGAGCATCTATCACGACGAGGTGGAGATCGAGG
ACTTCGAGTACGACGAGGAGGAGGAGATGTACTACTATCCCTGTCCATGC
GGCGATCGATTTCAGATCTCCAAGGAGGAGCTAATCGAGGGCGAGGAGGT
GGCCACCTGTCCCAGCTGCTCCCTAGTCATCAAGGTCATATACGATCCGG
AGATGTTCAAAGCTGAGGAGGATGAAGAAAGTGCGCTGAACGAGAAGCTC
GGCGACCTGAAGCTCGAGAAGAACTAAAAGCTTTCTAGACC
BS17188.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:05:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14701-PA | 261 | CG14701-RA | 1..261 | 17..277 | 1305 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 06:57:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14701-RA | 487 | CG14701-RA | 105..366 | 16..277 | 1310 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 06:57:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 11232016..11232125 | 16..125 | 550 | 100 | Plus |
3R | 32079331 | 3R | 11232340..11232418 | 199..277 | 395 | 100 | Plus |
3R | 32079331 | 3R | 11232192..11232269 | 123..200 | 390 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-13 06:57:51 has no hits.
BS17188.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:05:19 Download gff for
BS17188.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14701-PA | 1..261 | 17..277 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 20:47:14 Download gff for
BS17188.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14701-RA | 102..366 | 13..277 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 09:26:25 Download gff for
BS17188.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14701-RA | 102..366 | 13..277 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 09:26:25 Download gff for
BS17188.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 11232013..11232124 | 13..124 | 99 | -> | Plus |
3R | 11232194..11232268 | 125..199 | 100 | -> | Plus |
3R | 11232341..11232418 | 200..277 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 20:47:14 Download gff for
BS17188.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 7057735..7057846 | 13..124 | 99 | -> | Plus |
arm_3R | 7057916..7057990 | 125..199 | 100 | -> | Plus |
arm_3R | 7058063..7058140 | 200..277 | 100 | | Plus |
BS17188.complete Sequence
293 bp assembled on 2007-05-08
GenBank Submission: FJ638274
> BS17188.complete
GAAGTTATCAGTCGACATGAGCATCTATCACGACGAGGTGGAGATCGAGG
ACTTCGAGTACGACGAGGAGGAGGAGATGTACTACTATCCCTGTCCATGC
GGCGATCGATTTCAGATCTCCAAGGAGGAGCTAATCGAGGGCGAGGAGGT
GGCCACCTGTCCCAGCTGCTCCCTAGTCATCAAGGTCATATACGATCCGG
AGATGTTCAAAGCTGAGGAGGATGAAGAAAGTGCGCTGAACGAGAAGCTC
GGCGACCTGAAGCTCGAGAAGAACTAAAAGCTTTCTAGACCAT
BS17188.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:01:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14701-RA | 261 | CG14701-PA | 1..261 | 17..277 | 1305 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:01:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14701-RA | 487 | CG14701-RA | 105..366 | 16..277 | 1310 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:01:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 11232016..11232125 | 16..125 | 550 | 100 | Plus |
3R | 32079331 | 3R | 11232340..11232418 | 199..277 | 395 | 100 | Plus |
3R | 32079331 | 3R | 11232192..11232269 | 123..200 | 390 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 08:01:31 has no hits.
BS17188.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:45:56 Download gff for
BS17188.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14701-RA | 1..261 | 17..277 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:38:28 Download gff for
BS17188.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14701-RA | 1..259 | 17..275 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:12:44 Download gff for
BS17188.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14701-RA | 106..364 | 17..275 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:45:58 Download gff for
BS17188.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14701-RA | 1..261 | 17..277 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:09:19 Download gff for
BS17188.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14701-RA | 106..364 | 17..275 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:09:19 Download gff for
BS17188.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 11232017..11232124 | 17..124 | 100 | -> | Plus |
3R | 11232194..11232268 | 125..199 | 100 | -> | Plus |
3R | 11232341..11232416 | 200..275 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:12:44 Download gff for
BS17188.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 7057739..7057846 | 17..124 | 100 | -> | Plus |
arm_3R | 7057916..7057990 | 125..199 | 100 | -> | Plus |
arm_3R | 7058063..7058138 | 200..275 | 100 | | Plus |
BS17188.pep Sequence
Translation from 16 to 276
> BS17188.pep
MSIYHDEVEIEDFEYDEEEEMYYYPCPCGDRFQISKEELIEGEEVATCPS
CSLVIKVIYDPEMFKAEEDEESALNEKLGDLKLEKN*
BS17188.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:25:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14701-PA | 86 | CG14701-PA | 1..86 | 1..86 | 460 | 100 | Plus |