Clone BS17190 Report

Search the DGRC for BS17190

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:171
Well:90
Vector:pDNR-Dual
Associated Gene/TranscriptCG15127-RA
Protein status:BS17190.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS17190.3prime Sequence

288 bp (288 high quality bases) assembled on 2007-05-15

> BS17190.3prime
ATGGTCTAGAAAGCTTCTACATGATGACACACAGGCCACACTCCTCCATG
ACACAACAGGCTCCTAGCAGCATGCAGCACTCGGCGTCACTGGGTCCTTG
GGGGGGTCCTGGCTGATTGTAGCTGGGTTGCTCCACCACAACCACCGGCT
GGTTGTAAACGGGCGAGGGCATTATCACCTCTACGGGGGGCGGGGGTCCA
ATAACATTCACCACCTCCACGGGCGGCTGATAGTAGGGATCGATCACGTC
CACCTGGTAGCCTGCGTTGTACATGTCGACTGATAACT

BS17190.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:09:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG15127-PA 258 CG15127-RA 1..258 274..17 1290 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 04:25:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG15127-RA 624 CG15127-RA 116..374 274..16 1295 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 04:25:37
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19681018..19681276 16..274 1295 100 Plus
Blast to na_te.dros performed on 2015-02-11 04:25:42 has no hits.

BS17190.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:09:51 Download gff for BS17190.3prime
Subject Subject Range Query Range Percent Splice Strand
CG15127-PA 1..258 17..274 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 06:30:29 Download gff for BS17190.3prime
Subject Subject Range Query Range Percent Splice Strand
CG15127-RA 110..376 11..281 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 06:14:07 Download gff for BS17190.3prime
Subject Subject Range Query Range Percent Splice Strand
CG15127-RA 110..376 11..281 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 06:14:07 Download gff for BS17190.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 19681016..19681282 11..281 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 06:30:29 Download gff for BS17190.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15568521..15568787 11..281 97   Plus

BS17190.5prime Sequence

288 bp (288 high quality bases) assembled on 2007-05-15

> BS17190.5prime
GAAGTTATCAGTCGACATGTACAACGCAGGCTACCAGGTGGACGTGATCG
ATCCCTACTATCAGCCGCCCGTGGAGGTGGTGAATGTTATTGGACCCCCG
CCCCCCGTAGAGGTGATAATGCCCTCGCCCGTTTACAACCAGCCGGTGGT
TGTGGTGGAGCAACCCAGCTACAATCAGCCAGGACCCCCCCAAGGACCCA
GTGACGCCGAGTGCTGCATGCTGCTAGGAGCCTGTTGTGTCATGGAGGAG
TGTGGCCTGTGTGTCATCATGTAGAAGCTTTCTAGACC

BS17190.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:05:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG15127-PA 258 CG15127-RA 1..258 17..274 1290 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 02:46:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG15127-RA 624 CG15127-RA 116..374 17..275 1295 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 02:46:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19681018..19681276 275..17 1295 100 Minus
Blast to na_te.dros performed on 2015-02-11 02:46:04 has no hits.

BS17190.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:05:36 Download gff for BS17190.5prime
Subject Subject Range Query Range Percent Splice Strand
CG15127-PA 1..258 17..274 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-22 21:01:45 Download gff for BS17190.5prime
Subject Subject Range Query Range Percent Splice Strand
CG15127-RA 110..376 10..280 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 05:32:05 Download gff for BS17190.5prime
Subject Subject Range Query Range Percent Splice Strand
CG15127-RA 110..376 10..280 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 05:32:05 Download gff for BS17190.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 19681016..19681282 10..280 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-22 21:01:45 Download gff for BS17190.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15568521..15568787 10..280 97   Minus

BS17190.complete Sequence

290 bp assembled on 2007-05-08

GenBank Submission: FJ638275

> BS17190.complete
GAAGTTATCAGTCGACATGTACAACGCAGGCTACCAGGTGGACGTGATCG
ATCCCTACTATCAGCCGCCCGTGGAGGTGGTGAATGTTATTGGACCCCCG
CCCCCCGTAGAGGTGATAATGCCCTCGCCCGTTTACAACCAGCCGGTGGT
TGTGGTGGAGCAACCCAGCTACAATCAGCCAGGACCCCCCCAAGGACCCA
GTGACGCCGAGTGCTGCATGCTGCTAGGAGCCTGTTGTGTCATGGAGGAG
TGTGGCCTGTGTGTCATCATGTAGAAGCTTTCTAGACCAT

BS17190.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:50:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG15127-RA 258 CG15127-PA 1..258 17..274 1290 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:50:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG15127-RA 624 CG15127-RA 116..374 17..275 1295 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:50:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19681018..19681276 275..17 1295 100 Minus
Blast to na_te.dros performed on 2014-11-26 14:50:48 has no hits.

BS17190.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:57:15 Download gff for BS17190.complete
Subject Subject Range Query Range Percent Splice Strand
CG15127-RA 1..258 17..274 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:12:48 Download gff for BS17190.complete
Subject Subject Range Query Range Percent Splice Strand
CG15127-RA 92..358 10..280 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:43:57 Download gff for BS17190.complete
Subject Subject Range Query Range Percent Splice Strand
CG15127-RA 116..373 17..274 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:57:15 Download gff for BS17190.complete
Subject Subject Range Query Range Percent Splice Strand
CG15127-RA 92..358 10..280 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:01:20 Download gff for BS17190.complete
Subject Subject Range Query Range Percent Splice Strand
CG15127-RA 116..373 17..274 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:01:20 Download gff for BS17190.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19681019..19681276 17..274 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:43:57 Download gff for BS17190.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15568524..15568781 17..274 100   Minus

BS17190.pep Sequence

Translation from 16 to 273

> BS17190.pep
MYNAGYQVDVIDPYYQPPVEVVNVIGPPPPVEVIMPSPVYNQPVVVVEQP
SYNQPGPPQGPSDAECCMLLGACCVMEECGLCVIM*

BS17190.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:25:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG15127-PA 85 CG15127-PA 1..85 1..85 476 100 Plus