Clone BS17195 Report

Search the DGRC for BS17195

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:171
Well:95
Vector:pDNR-Dual
Associated Gene/TranscriptCG31704-RA
Protein status:BS17195.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS17195.3prime Sequence

237 bp (237 high quality bases) assembled on 2007-05-15

> BS17195.3prime
ATGGTCTAGAAAGCTTCTAGCATCTTCCCTTCTTCTCCACGGTAATGGAG
CGTCCTTCTTTAATTAAACAATCCAAAACACACTGGTTACTATAGGTCAC
GGAGTCCGATCCGCACACAGGATCATAGTTTCGAGGACACGGGCAGGAGT
ACTGGAATACCTGGCCCACAGCCATGGCCAAAAGAGCAGACAGACAGAAA
GCGATGAAGGCTAGGCAACGCATGTCGACTGATAACT

BS17195.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:09:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG31704-PA 207 CG31704-RA 1..207 223..17 1035 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 16:46:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG31704-RB 514 CG31704-RB 21..230 224..15 1050 100 Minus
CG31704-RA 308 CG31704-RA 21..230 224..15 1050 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 16:46:09
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11840711..11840920 224..15 1050 100 Minus
Blast to na_te.dros performed on 2015-02-11 16:46:13 has no hits.

BS17195.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:09:47 Download gff for BS17195.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31704-PA 1..207 17..223 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 19:51:51 Download gff for BS17195.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31704-RA 21..230 15..224 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:45:52 Download gff for BS17195.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31704-RA 21..230 15..224 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:45:52 Download gff for BS17195.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 11840711..11840920 15..224 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 19:51:51 Download gff for BS17195.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11840711..11840920 15..224 100   Minus

BS17195.5prime Sequence

237 bp (237 high quality bases) assembled on 2007-05-15

> BS17195.5prime
GAAGTTATCAGTCGACATGCGTTGCCTAGCCTTCATCGCTTTCTGTCTGT
CTGCTCTTTTGGCCATGGCTGTGGGCCAGGTATTCCAGTACTCCTGCCCG
TGTCCTCGAAACTATGATCCTGTGTGCGGATCGGACTCCGTGACCTATAG
TAACCAGTGTGTTTTGGATTGTTTAATTAAAGAAGGACGCTCCATTACCG
TGGAGAAGAAGGGAAGATGCTAGAAGCTTTCTAGACC

BS17195.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:05:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG31704-PA 207 CG31704-RA 1..207 17..223 1035 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 06:58:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG31704-RB 514 CG31704-RB 21..230 16..225 1050 100 Plus
CG31704-RA 308 CG31704-RA 21..230 16..225 1050 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 06:57:58
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11840711..11840920 16..225 1050 100 Plus
Blast to na_te.dros performed on 2015-02-13 06:57:59 has no hits.

BS17195.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:05:32 Download gff for BS17195.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31704-PA 1..207 17..223 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 20:47:18 Download gff for BS17195.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31704-RA 21..230 16..225 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 09:26:52 Download gff for BS17195.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31704-RA 21..230 16..225 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 09:26:52 Download gff for BS17195.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 11840711..11840920 16..225 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 20:47:18 Download gff for BS17195.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11840711..11840920 16..225 100   Plus

BS17195.complete Sequence

239 bp assembled on 2007-05-08

GenBank Submission: FJ638277

> BS17195.complete
GAAGTTATCAGTCGACATGCGTTGCCTAGCCTTCATCGCTTTCTGTCTGT
CTGCTCTTTTGGCCATGGCTGTGGGCCAGGTATTCCAGTACTCCTGCCCG
TGTCCTCGAAACTATGATCCTGTGTGCGGATCGGACTCCGTGACCTATAG
TAACCAGTGTGTTTTGGATTGTTTAATTAAAGAAGGACGCTCCATTACCG
TGGAGAAGAAGGGAAGATGCTAGAAGCTTTCTAGACCAT

BS17195.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:41:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG31704-RB 207 CG31704-PB 1..207 17..223 1035 100 Plus
CG31704-RA 207 CG31704-PA 1..207 17..223 1035 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:41:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG31704-RB 514 CG31704-RB 21..230 16..225 1050 100 Plus
CG31704-RA 308 CG31704-RA 21..230 16..225 1050 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:41:18
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11840711..11840920 16..225 1050 100 Plus
Blast to na_te.dros performed on 2014-11-27 13:41:20 has no hits.

BS17195.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:19:20 Download gff for BS17195.complete
Subject Subject Range Query Range Percent Splice Strand
CG31704-RA 1..207 17..223 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:50:53 Download gff for BS17195.complete
Subject Subject Range Query Range Percent Splice Strand
CG31704-RA 21..230 16..225 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:22:10 Download gff for BS17195.complete
Subject Subject Range Query Range Percent Splice Strand
CG31704-RA 22..228 17..223 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:19:20 Download gff for BS17195.complete
Subject Subject Range Query Range Percent Splice Strand
CG31704-RA 1..207 17..223 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:53:40 Download gff for BS17195.complete
Subject Subject Range Query Range Percent Splice Strand
CG31704-RA 22..228 17..223 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:53:40 Download gff for BS17195.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11840712..11840918 17..223 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:22:10 Download gff for BS17195.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11840712..11840918 17..223 100   Plus

BS17195.pep Sequence

Translation from 16 to 222

> BS17195.pep
MRCLAFIAFCLSALLAMAVGQVFQYSCPCPRNYDPVCGSDSVTYSNQCVL
DCLIKEGRSITVEKKGRC*

BS17195.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:18:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG31704-PB 68 CG31704-PB 1..68 1..68 370 100 Plus
CG31704-PA 68 CG31704-PA 1..68 1..68 370 100 Plus
CG45011-PB 67 CG45011-PB 6..67 6..68 160 52.4 Plus
CG45011-PA 67 CG45011-PA 6..67 6..68 160 52.4 Plus
Sfp33A3-PA 99 CG42474-PA 1..65 1..68 153 50 Plus