Clone BS17201 Report

Search the DGRC for BS17201

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:172
Well:1
Vector:pDNR-Dual
Associated Gene/TranscriptCG32069-RA
Protein status:BS17201.pep: full length peptide match
Sequenced Size:275

Clone Sequence Records

BS17201.complete Sequence

275 bp assembled on 2010-02-09

GenBank Submission: KX800837

> BS17201.complete
GAAGTTATCAGTCGACATGTTTACTTTGTGGACACTGATTGAATCTTCAC
TCCTGTGCCTGAATGCGGTGTGCATTCTGCACGAGGAACGCTTTCTGGCC
AAGTTTGGCTGGGGACGACAGGCGGGCCAGCAGGACTTTGGAGCACCTAC
GGCCAAGGATCAGGTGCTAAACCTCATTCGTTCCATACGCACAGTGGCCA
AAATTCCCCTGATATTCCTTAACATAATTGCGATTATATTTAAACTATTA
CTTGGTTGAAAGCTTTCTAGACCAT

BS17201.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:44:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG32069-RA 243 CG32069-PA 1..243 17..259 1215 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:44:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG32069-RA 356 CG32069-RA 72..314 17..259 1215 100 Plus
Blos2-RA 645 CG14145-RA 603..645 259..217 215 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:44:15
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11062291..11062389 203..105 495 100 Minus
3L 28110227 3L 11062456..11062543 104..17 440 100 Minus
3L 28110227 3L 11062173..11062228 259..204 280 100 Minus
Blast to na_te.dros performed on 2014-11-28 04:44:15 has no hits.

BS17201.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:18:50 Download gff for BS17201.complete
Subject Subject Range Query Range Percent Splice Strand
CG32069-RA 1..243 17..259 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-09 18:13:28 Download gff for BS17201.complete
Subject Subject Range Query Range Percent Splice Strand
CG32069-RA 78..313 23..258 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:03:59 Download gff for BS17201.complete
Subject Subject Range Query Range Percent Splice Strand
CG32069-RA 78..313 23..258 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:18:51 Download gff for BS17201.complete
Subject Subject Range Query Range Percent Splice Strand
CG32069-RA 1..243 17..259 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:35:50 Download gff for BS17201.complete
Subject Subject Range Query Range Percent Splice Strand
CG32069-RA 78..313 23..258 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:35:50 Download gff for BS17201.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11062174..11062228 204..258 100 <- Minus
3L 11062291..11062389 105..203 100 <- Minus
3L 11062456..11062537 23..104 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:03:59 Download gff for BS17201.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11055274..11055328 204..258 100 <- Minus
arm_3L 11055391..11055489 105..203 100 <- Minus
arm_3L 11055556..11055637 23..104 100   Minus

BS17201.5prime Sequence

273 bp (273 high quality bases) assembled on 2007-05-15

> BS17201.5prime
GAAGTTATCAGTCGACATGTTTACTTTGTGGACACTGATTGAATCTTCAC
TCCTGTGCCTGAATGCGGTGTGCATTCTGCACGAGGAACGCTTTCTGGCC
AAGTTTGGCTGGGGACGACAGGCGGGCCAGCAGGACTTTGGAGCACCTAC
GGCCAAGGATCAGGTGCTAAACCTCATTCGTTCCATACGCACAGTGGCCA
AAATTCCCCTGATATTCCTTAACATAATTGCGATTATATTTAAACTATTA
CTTGGTTGAAAGCTTTCTAGACC

BS17201.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:10:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG32069-PA 243 CG32069-RA 1..243 17..259 1215 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 22:04:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG32069-RA 356 CG32069-RA 72..314 17..259 1215 100 Plus
Blos2-RA 645 CG14145-RA 603..645 259..217 215 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 22:04:49
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11062291..11062389 203..105 495 100 Minus
3L 28110227 3L 11062456..11062543 104..17 440 100 Minus
3L 28110227 3L 11062173..11062228 259..204 280 100 Minus
Blast to na_te.dros performed on 2015-02-11 22:04:51 has no hits.

BS17201.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:10:25 Download gff for BS17201.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32069-PA 1..243 17..259 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 02:32:38 Download gff for BS17201.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32069-RA 72..314 17..259 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 00:59:26 Download gff for BS17201.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32069-RA 72..314 17..259 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 00:59:26 Download gff for BS17201.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 11062173..11062228 204..259 100 <- Minus
3L 11062291..11062389 105..203 100 <- Minus
3L 11062456..11062543 17..104 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 02:32:38 Download gff for BS17201.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11055273..11055328 204..259 100 <- Minus
arm_3L 11055391..11055489 105..203 100 <- Minus
arm_3L 11055556..11055643 17..104 100   Minus

BS17201.3prime Sequence

273 bp (273 high quality bases) assembled on 2007-05-15

> BS17201.3prime
ATGGTCTAGAAAGCTTTCAACCAAGTAATAGTTTAAATATAATCGCAATT
ATGTTAAGGAATATCAGGGGAATTTTGGCCACTGTGCGTATGGAACGAAT
GAGGTTTAGCACCTGATCCTTGGCCGTAGGTGCTCCAAAGTCCTGCTGGC
CCGCCTGTCGTCCCCAGCCAAACTTGGCCAGAAAGCGTTCCTCGTGCAGA
ATGCACACCGCATTCAGGCACAGGAGTGAAGATTCAATCAGTGTCCACAA
AGTAAACATGTCGACTGATAACT

BS17201.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:16:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG32069-PA 243 CG32069-RA 1..243 259..17 1215 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 05:59:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG32069-RA 356 CG32069-RA 72..314 259..17 1215 100 Minus
Blos2-RA 645 CG14145-RA 603..645 17..59 215 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 05:59:02
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11062291..11062389 73..171 495 100 Plus
3L 28110227 3L 11062456..11062543 172..259 440 100 Plus
3L 28110227 3L 11062173..11062228 17..72 280 100 Plus
Blast to na_te.dros performed on 2015-02-13 05:59:04 has no hits.

BS17201.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:16:45 Download gff for BS17201.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32069-PA 1..243 17..259 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 18:47:38 Download gff for BS17201.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32069-RA 72..314 17..259 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 08:05:42 Download gff for BS17201.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32069-RA 72..314 17..259 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 08:05:42 Download gff for BS17201.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 11062173..11062228 17..72 100 <- Plus
3L 11062291..11062389 73..171 100 <- Plus
3L 11062456..11062543 172..259 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 18:47:38 Download gff for BS17201.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11055273..11055328 17..72 100 <- Plus
arm_3L 11055391..11055489 73..171 100 <- Plus
arm_3L 11055556..11055643 172..259 100   Plus

BS17201.pep Sequence

Translation from 16 to 258

> BS17201.pep
MFTLWTLIESSLLCLNAVCILHEERFLAKFGWGRQAGQQDFGAPTAKDQV
LNLIRSIRTVAKIPLIFLNIIAIIFKLLLG*

BS17201.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:01:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG32069-PA 80 CG32069-PA 1..80 1..80 406 100 Plus