Clone BS17202 Report

Search the DGRC for BS17202

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:172
Well:2
Vector:pDNR-Dual
Associated Gene/Transcriptubl-RA
Protein status:BS17202.pep: full length peptide match
Sequenced Size:254

Clone Sequence Records

BS17202.3prime Sequence

252 bp (252 high quality bases) assembled on 2007-05-15

> BS17202.3prime
ATGGTCTAGAAAGCTTTTATTGGTAGTAAAGTTCCAGATTCATGCCATCG
TGAATTTCATAGTCAGATAGGCGAATCGGGTCCTTGAAGATTGTGTACCA
CTTCTTCAGGACAATCTTCTCGTGCTTTGTGCCCGTTTGTGCCGCGATTA
GTTTCTTGAGGTCCCCAATCGTGTCGTCCGGGTTGCACTTGACGCGCACC
TTCTTGCCAAGACGATCGTTACACGTTATTTCTATCATGTCGACTGATAA
CT

BS17202.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:16:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG3450-PA 222 l(2)k03203-RA 1..222 238..17 1110 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 03:44:55
Subject Length Description Subject Range Query Range Score Percent Strand
ubl-RA 396 CG3450-RA 94..317 238..15 1120 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 03:44:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6810201..6810341 61..201 705 100 Plus
2R 25286936 2R 6810090..6810135 15..60 230 100 Plus
2R 25286936 2R 6810397..6810437 198..238 205 100 Plus
Blast to na_te.dros performed on 2015-02-11 03:44:53 has no hits.

BS17202.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:16:54 Download gff for BS17202.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3450-PA 1..222 17..238 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 06:26:34 Download gff for BS17202.3prime
Subject Subject Range Query Range Percent Splice Strand
ubl-RA 94..324 6..238 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 05:29:26 Download gff for BS17202.3prime
Subject Subject Range Query Range Percent Splice Strand
ubl-RA 94..324 6..238 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 05:29:26 Download gff for BS17202.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 6810083..6810135 6..60 92 <- Plus
2R 6810201..6810339 61..199 100 <- Plus
2R 6810399..6810437 200..238 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 06:26:34 Download gff for BS17202.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2697588..2697640 6..60 92 <- Plus
arm_2R 2697706..2697844 61..199 100 <- Plus
arm_2R 2697904..2697942 200..238 100   Plus

BS17202.complete Sequence

254 bp assembled on 2010-02-09

GenBank Submission: KX804860

> BS17202.complete
GAAGTTATCAGTCGACATGATAGAAATAACGTGTAACGATCGTCTTGGCA
AGAAGGTGCGCGTCAAGTGCAACCCGGACGACACGATTGGGGACCTCAAG
AAACTAATCGCGGCACAAACGGGCACAAAGCACGAGAAGATTGTCCTGAA
GAAGTGGTACACAATCTTCAAGGACCCGATTCGCCTATCTGACTATGAAA
TTCACGATGGCATGAATCTGGAACTTTACTACCAATAAAAGCTTTCTAGA
CCAT

BS17202.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 03:13:08
Subject Length Description Subject Range Query Range Score Percent Strand
ubl-RA 222 CG3450-PA 1..222 17..238 1110 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:13:09
Subject Length Description Subject Range Query Range Score Percent Strand
ubl-RA 396 CG3450-RA 94..317 17..240 1120 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 03:13:06
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6810201..6810341 194..54 705 100 Minus
2R 25286936 2R 6810090..6810135 240..195 230 100 Minus
2R 25286936 2R 6810397..6810437 57..17 205 100 Minus
Blast to na_te.dros performed on 2014-11-28 03:13:07 has no hits.

BS17202.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:46:16 Download gff for BS17202.complete
Subject Subject Range Query Range Percent Splice Strand
ubl-RA 1..222 17..238 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-09 18:16:42 Download gff for BS17202.complete
Subject Subject Range Query Range Percent Splice Strand
ubl-RA 78..297 17..236 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:38:23 Download gff for BS17202.complete
Subject Subject Range Query Range Percent Splice Strand
ubl-RA 94..313 17..236 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:46:16 Download gff for BS17202.complete
Subject Subject Range Query Range Percent Splice Strand
ubl-RA 78..308 17..249 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:45:24 Download gff for BS17202.complete
Subject Subject Range Query Range Percent Splice Strand
ubl-RA 94..313 17..236 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:45:24 Download gff for BS17202.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6810094..6810135 195..236 100 <- Minus
2R 6810201..6810339 56..194 100 <- Minus
2R 6810399..6810437 17..55 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:38:23 Download gff for BS17202.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2697706..2697844 56..194 100 <- Minus
arm_2R 2697904..2697942 17..55 100   Minus
arm_2R 2697599..2697640 195..236 100 <- Minus

BS17202.5prime Sequence

252 bp (252 high quality bases) assembled on 2007-05-15

> BS17202.5prime
GAAGTTATCAGTCGACATGATAGAAATAACGTGTAACGATCGTCTTGGCA
AGAAGGTGCGCGTCAAGTGCAACCCGGACGACACGATTGGGGACCTCAAG
AAACTAATCGCGGCACAAACGGGCACAAAGCACGAGAAGATTGTCCTGAA
GAAGTGGTACACAATCTTCAAGGACCCGATTCGCCTATCTGACTATGAAA
TTCACGATGGCATGAATCTGGAACTTTACTACCAATAAAAGCTTTCTAGA
CC

BS17202.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:10:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG3450-PA 222 l(2)k03203-RA 1..222 17..238 1110 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 00:20:42
Subject Length Description Subject Range Query Range Score Percent Strand
ubl-RA 396 CG3450-RA 94..317 17..240 1120 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 00:20:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6810201..6810341 194..54 705 100 Minus
2R 25286936 2R 6810090..6810135 240..195 230 100 Minus
2R 25286936 2R 6810397..6810437 57..17 205 100 Minus
Blast to na_te.dros performed on 2015-02-13 00:20:39 has no hits.

BS17202.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:10:33 Download gff for BS17202.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3450-PA 1..222 17..238 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 21:55:28 Download gff for BS17202.5prime
Subject Subject Range Query Range Percent Splice Strand
ubl-RA 94..324 17..249 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 02:49:22 Download gff for BS17202.5prime
Subject Subject Range Query Range Percent Splice Strand
ubl-RA 94..324 17..249 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 02:49:22 Download gff for BS17202.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 6810083..6810135 195..249 92 <- Minus
2R 6810201..6810339 56..194 100 <- Minus
2R 6810399..6810437 17..55 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 21:55:28 Download gff for BS17202.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2697588..2697640 195..249 92 <- Minus
arm_2R 2697706..2697844 56..194 100 <- Minus
arm_2R 2697904..2697942 17..55 100   Minus

BS17202.pep Sequence

Translation from 16 to 237

> BS17202.pep
MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTKHEKIVLKKWYTI
FKDPIRLSDYEIHDGMNLELYYQ*

BS17202.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:01:39
Subject Length Description Subject Range Query Range Score Percent Strand
ubl-PA 73 CG3450-PA 1..73 1..73 391 100 Plus