Clone Sequence Records
BS17202.3prime Sequence
252 bp (252 high quality bases) assembled on 2007-05-15
> BS17202.3prime
ATGGTCTAGAAAGCTTTTATTGGTAGTAAAGTTCCAGATTCATGCCATCG
TGAATTTCATAGTCAGATAGGCGAATCGGGTCCTTGAAGATTGTGTACCA
CTTCTTCAGGACAATCTTCTCGTGCTTTGTGCCCGTTTGTGCCGCGATTA
GTTTCTTGAGGTCCCCAATCGTGTCGTCCGGGTTGCACTTGACGCGCACC
TTCTTGCCAAGACGATCGTTACACGTTATTTCTATCATGTCGACTGATAA
CT
BS17202.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:16:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3450-PA | 222 | l(2)k03203-RA | 1..222 | 238..17 | 1110 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 03:44:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ubl-RA | 396 | CG3450-RA | 94..317 | 238..15 | 1120 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 03:44:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 6810201..6810341 | 61..201 | 705 | 100 | Plus |
2R | 25286936 | 2R | 6810090..6810135 | 15..60 | 230 | 100 | Plus |
2R | 25286936 | 2R | 6810397..6810437 | 198..238 | 205 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-11 03:44:53 has no hits.
BS17202.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:16:54 Download gff for
BS17202.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3450-PA | 1..222 | 17..238 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 06:26:34 Download gff for
BS17202.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ubl-RA | 94..324 | 6..238 | 98 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 05:29:26 Download gff for
BS17202.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ubl-RA | 94..324 | 6..238 | 98 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 05:29:26 Download gff for
BS17202.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 6810083..6810135 | 6..60 | 92 | <- | Plus |
2R | 6810201..6810339 | 61..199 | 100 | <- | Plus |
2R | 6810399..6810437 | 200..238 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 06:26:34 Download gff for
BS17202.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 2697588..2697640 | 6..60 | 92 | <- | Plus |
arm_2R | 2697706..2697844 | 61..199 | 100 | <- | Plus |
arm_2R | 2697904..2697942 | 200..238 | 100 | | Plus |
BS17202.complete Sequence
254 bp assembled on 2010-02-09
GenBank Submission: KX804860
> BS17202.complete
GAAGTTATCAGTCGACATGATAGAAATAACGTGTAACGATCGTCTTGGCA
AGAAGGTGCGCGTCAAGTGCAACCCGGACGACACGATTGGGGACCTCAAG
AAACTAATCGCGGCACAAACGGGCACAAAGCACGAGAAGATTGTCCTGAA
GAAGTGGTACACAATCTTCAAGGACCCGATTCGCCTATCTGACTATGAAA
TTCACGATGGCATGAATCTGGAACTTTACTACCAATAAAAGCTTTCTAGA
CCAT
BS17202.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 03:13:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ubl-RA | 222 | CG3450-PA | 1..222 | 17..238 | 1110 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:13:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ubl-RA | 396 | CG3450-RA | 94..317 | 17..240 | 1120 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 03:13:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 6810201..6810341 | 194..54 | 705 | 100 | Minus |
2R | 25286936 | 2R | 6810090..6810135 | 240..195 | 230 | 100 | Minus |
2R | 25286936 | 2R | 6810397..6810437 | 57..17 | 205 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 03:13:07 has no hits.
BS17202.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:46:16 Download gff for
BS17202.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ubl-RA | 1..222 | 17..238 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-09 18:16:42 Download gff for
BS17202.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ubl-RA | 78..297 | 17..236 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:38:23 Download gff for
BS17202.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ubl-RA | 94..313 | 17..236 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:46:16 Download gff for
BS17202.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ubl-RA | 78..308 | 17..249 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:45:24 Download gff for
BS17202.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ubl-RA | 94..313 | 17..236 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:45:24 Download gff for
BS17202.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 6810094..6810135 | 195..236 | 100 | <- | Minus |
2R | 6810201..6810339 | 56..194 | 100 | <- | Minus |
2R | 6810399..6810437 | 17..55 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:38:23 Download gff for
BS17202.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 2697706..2697844 | 56..194 | 100 | <- | Minus |
arm_2R | 2697904..2697942 | 17..55 | 100 | | Minus |
arm_2R | 2697599..2697640 | 195..236 | 100 | <- | Minus |
BS17202.5prime Sequence
252 bp (252 high quality bases) assembled on 2007-05-15
> BS17202.5prime
GAAGTTATCAGTCGACATGATAGAAATAACGTGTAACGATCGTCTTGGCA
AGAAGGTGCGCGTCAAGTGCAACCCGGACGACACGATTGGGGACCTCAAG
AAACTAATCGCGGCACAAACGGGCACAAAGCACGAGAAGATTGTCCTGAA
GAAGTGGTACACAATCTTCAAGGACCCGATTCGCCTATCTGACTATGAAA
TTCACGATGGCATGAATCTGGAACTTTACTACCAATAAAAGCTTTCTAGA
CC
BS17202.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:10:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3450-PA | 222 | l(2)k03203-RA | 1..222 | 17..238 | 1110 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 00:20:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ubl-RA | 396 | CG3450-RA | 94..317 | 17..240 | 1120 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 00:20:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 6810201..6810341 | 194..54 | 705 | 100 | Minus |
2R | 25286936 | 2R | 6810090..6810135 | 240..195 | 230 | 100 | Minus |
2R | 25286936 | 2R | 6810397..6810437 | 57..17 | 205 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-13 00:20:39 has no hits.
BS17202.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:10:33 Download gff for
BS17202.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3450-PA | 1..222 | 17..238 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 21:55:28 Download gff for
BS17202.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ubl-RA | 94..324 | 17..249 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 02:49:22 Download gff for
BS17202.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ubl-RA | 94..324 | 17..249 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 02:49:22 Download gff for
BS17202.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 6810083..6810135 | 195..249 | 92 | <- | Minus |
2R | 6810201..6810339 | 56..194 | 100 | <- | Minus |
2R | 6810399..6810437 | 17..55 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 21:55:28 Download gff for
BS17202.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 2697588..2697640 | 195..249 | 92 | <- | Minus |
arm_2R | 2697706..2697844 | 56..194 | 100 | <- | Minus |
arm_2R | 2697904..2697942 | 17..55 | 100 | | Minus |
BS17202.pep Sequence
Translation from 16 to 237
> BS17202.pep
MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTKHEKIVLKKWYTI
FKDPIRLSDYEIHDGMNLELYYQ*
BS17202.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:01:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ubl-PA | 73 | CG3450-PA | 1..73 | 1..73 | 391 | 100 | Plus |