Clone BS17204 Report

Search the DGRC for BS17204

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:172
Well:4
Vector:pDNR-Dual
Associated Gene/TranscriptCG15213-RA
Protein status:BS17204.pep: full length peptide match
Sequenced Size:221

Clone Sequence Records

BS17204.complete Sequence

221 bp assembled on 2010-02-09

GenBank Submission: KX805572

> BS17204.complete
GAAGTTATCAGTCGACATGAAGTTCTTGCTCCTGAGCGTCTTCCTTTGCC
TTGCCGTGTGCTTCATGGCCACCAGTGCTGCTCCTCGCGAGGAGGCCATT
CCCGATGGCTTCGAAGGTCCTGGCAGTGAGTCCGTCAACCCATCCGACGA
CCAATCCTTCCTGCTCAAGCTGAAGCTGCTCAAGAAGCTGCTGTTCCTGG
GCTAGAAGCTTTCTAGACCAT

BS17204.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 03:11:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG15213-RA 189 CG15213-PA 1..189 17..205 945 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:11:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG15213-RA 366 CG15213-RA 74..265 15..206 960 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 03:11:44
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 5132897..5133069 206..34 865 100 Minus
Blast to na_te.dros performed on 2014-11-28 03:11:45 has no hits.

BS17204.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:28:34 Download gff for BS17204.complete
Subject Subject Range Query Range Percent Splice Strand
CG15213-RA 1..189 17..205 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-09 18:16:24 Download gff for BS17204.complete
Subject Subject Range Query Range Percent Splice Strand
CG15213-RA 1..189 17..205 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:37:48 Download gff for BS17204.complete
Subject Subject Range Query Range Percent Splice Strand
CG15213-RA 76..264 17..205 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:28:34 Download gff for BS17204.complete
Subject Subject Range Query Range Percent Splice Strand
CG15213-RA 1..189 17..205 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:44:59 Download gff for BS17204.complete
Subject Subject Range Query Range Percent Splice Strand
CG15213-RA 76..264 17..205 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:44:59 Download gff for BS17204.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5133128..5133145 17..34 100   Minus
3L 5132898..5133068 35..205 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:37:48 Download gff for BS17204.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 5125998..5126168 35..205 100 <- Minus
arm_3L 5126228..5126245 17..34 100   Minus

BS17204.3prime Sequence

219 bp (219 high quality bases) assembled on 2007-05-15

> BS17204.3prime
ATGGTCTAGAAAGCTTCTAGCCCAGGAACAGCAGCTTCTTGAGCAGCTTC
AGCTTGAGCAGGAAGGATTGGTCGTCGGATGGGTTGACGGACTCACTGCC
AGGACCTTCGAAGCCATCGGGAATGGCCTCCTCGCGAGGAGCAGCACTGG
TGGCCATGAAGCACACGGCAAGGCAAAGGAAGACGCTCAGGAGCAAGAAC
TTCATGTCGACTGATAACT

BS17204.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:20:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG15213-PA 189 CG15213-RA 1..189 205..17 945 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 06:41:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG15213-RA 366 CG15213-RA 74..265 207..16 960 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 06:41:15
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 5132897..5133069 16..188 865 100 Plus
Blast to na_te.dros performed on 2015-02-13 06:41:16 has no hits.

BS17204.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:20:17 Download gff for BS17204.3prime
Subject Subject Range Query Range Percent Splice Strand
CG15213-PA 1..189 17..205 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 20:20:43 Download gff for BS17204.3prime
Subject Subject Range Query Range Percent Splice Strand
CG15213-RA 68..265 16..213 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 09:23:56 Download gff for BS17204.3prime
Subject Subject Range Query Range Percent Splice Strand
CG15213-RA 68..265 16..213 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 09:23:56 Download gff for BS17204.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 5132897..5133068 16..187 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 20:20:43 Download gff for BS17204.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 5125997..5126168 16..187 100 <- Plus

BS17204.5prime Sequence

219 bp (219 high quality bases) assembled on 2007-05-15

> BS17204.5prime
GAAGTTATCAGTCGACATGAAGTTCTTGCTCCTGAGCGTCTTCCTTTGCC
TTGCCGTGTGCTTCATGGCCACCAGTGCTGCTCCTCGCGAGGAGGCCATT
CCCGATGGCTTCGAAGGTCCTGGCAGTGAGTCCGTCAACCCATCCGACGA
CCAATCCTTCCTGCTCAAGCTGAAGCTGCTCAAGAAGCTGCTGTTCCTGG
GCTAGAAGCTTTCTAGACC

BS17204.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:13:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG15213-PA 189 CG15213-RA 1..189 17..205 945 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-04 21:08:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG15213-RA 366 CG15213-RA 74..265 15..206 960 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-04 21:08:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 5132897..5133069 206..34 865 100 Minus
Blast to na_te.dros performed on 2015-02-04 21:08:18 has no hits.

BS17204.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:13:42 Download gff for BS17204.5prime
Subject Subject Range Query Range Percent Splice Strand
CG15213-PA 1..189 17..205 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-10 21:29:44 Download gff for BS17204.5prime
Subject Subject Range Query Range Percent Splice Strand
CG15213-RA 68..265 9..206 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-04 21:55:15 Download gff for BS17204.5prime
Subject Subject Range Query Range Percent Splice Strand
CG15213-RA 68..265 9..206 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-04 21:55:15 Download gff for BS17204.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 5132897..5133068 35..206 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-10 21:29:44 Download gff for BS17204.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 5125997..5126168 35..206 100 <- Minus

BS17204.pep Sequence

Translation from 16 to 204

> BS17204.pep
MKFLLLSVFLCLAVCFMATSAAPREEAIPDGFEGPGSESVNPSDDQSFLL
KLKLLKKLLFLG*

BS17204.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:06:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG15213-PA 62 CG15213-PA 1..62 1..62 312 100 Plus