Clone Sequence Records
BS17205.complete Sequence
287 bp assembled on 2010-02-09
GenBank Submission: KX801990
> BS17205.complete
GAAGTTATCAGTCGACATGCGACGCCGCGAACTGCAGACCATCCAGCTGA
AGCTGTCCGATCTCAAGGAGTACGAGCAGGCTAAGATGGAGCGCCTGAGG
AACCGCCAACAATTGCTTACTCCCCGGACGCCTACACCCCCTTCCGACAG
CGAAGTCCTGCCGGCGACCTCCAGCAGCGTTCCAGCTGTTCTCCTGGCCA
GCGGCAAGAACCTGGACGATGACGCCGACAAGTCAGAGCCCACAACCAAG
CCCAGCACATCCTCCACCTAGAAGCTTTCTAGACCAT
BS17205.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 03:11:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17343-RA | 255 | CG17343-PA | 1..255 | 17..271 | 1275 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:11:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG10702-RD | 4041 | CG10702-RD | 3626..3880 | 271..17 | 1275 | 100 | Minus |
CG17343-RA | 571 | CG17343-RA | 65..319 | 17..271 | 1275 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 03:11:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 19064993..19065247 | 17..271 | 1275 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 03:11:54 has no hits.
BS17205.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:28:35 Download gff for
BS17205.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17343-RA | 1..255 | 17..271 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-09 18:16:25 Download gff for
BS17205.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17343-RA | 1..255 | 17..271 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:37:52 Download gff for
BS17205.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10702-RD | 3626..3880 | 17..271 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:28:35 Download gff for
BS17205.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17343-RA | 1..255 | 17..271 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:45:03 Download gff for
BS17205.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17343-RA | 65..319 | 17..271 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:45:03 Download gff for
BS17205.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 19064993..19065247 | 17..271 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:37:52 Download gff for
BS17205.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 19064993..19065247 | 17..271 | 100 | | Plus |
BS17205.3prime Sequence
285 bp (285 high quality bases) assembled on 2007-05-15
> BS17205.3prime
ATGGTCTAGAAAGCTTCTAGGTGGAGGATGTGCTGGGCTTGGTTGTGGGC
TCTGACTTGTCGGCGTCATCGTCCAGGTTCTTGCCGCTGGCCAGGAGAAC
AGCTGGAACGCTGCTGGAGGTCGCCGGCAGGACTTCGCTGTCGGAAGGGG
GTGTAGGCGTCCGGGGAGTAAGCAATTGTTGGCGGTTCCTCAGGCGCTCC
ATCTTAGCCTGCTCGTACTCCTTGAGATCGGACAGCTTCAGCTGGATGGT
CTGCAGTTCGCGGCGTCGCATGTCGACTGATAACT
BS17205.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:20:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17343-PA | 255 | CG17343-RA | 1..255 | 271..17 | 1275 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 15:24:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG10702-RD | 4041 | CG10702-RD | 3626..3880 | 17..271 | 1275 | 100 | Plus |
CG17343-RA | 571 | CG17343-RA | 65..319 | 271..17 | 1275 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 15:24:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 19064993..19065247 | 271..17 | 1275 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-10 15:24:04 has no hits.
BS17205.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:20:26 Download gff for
BS17205.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17343-PA | 1..255 | 17..271 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 02:34:03 Download gff for
BS17205.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10702-RD | 3626..3880 | 17..271 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:24:15 Download gff for
BS17205.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17343-RA | 65..319 | 17..271 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:24:15 Download gff for
BS17205.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 19064993..19065247 | 17..271 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 02:34:03 Download gff for
BS17205.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 19064993..19065247 | 17..271 | 100 | | Minus |
BS17205.5prime Sequence
285 bp (285 high quality bases) assembled on 2007-05-15
> BS17205.5prime
GAAGTTATCAGTCGACATGCGACGCCGCGAACTGCAGACCATCCAGCTGA
AGCTGTCCGATCTCAAGGAGTACGAGCAGGCTAAGATGGAGCGCCTGAGG
AACCGCCAACAATTGCTTACTCCCCGGACGCCTACACCCCCTTCCGACAG
CGAAGTCCTGCCGGCGACCTCCAGCAGCGTTCCAGCTGTTCTCCTGGCCA
GCGGCAAGAACCTGGACGATGACGCCGACAAGTCAGAGCCCACAACCAAG
CCCAGCACATCCTCCACCTAGAAGCTTTCTAGACC
BS17205.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:13:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17343-PA | 255 | CG17343-RA | 1..255 | 17..271 | 1275 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 02:30:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG10702-RD | 4041 | CG10702-RD | 3626..3880 | 271..17 | 1275 | 100 | Minus |
CG17343-RA | 571 | CG17343-RA | 65..319 | 17..271 | 1275 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 02:30:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 19064993..19065247 | 17..271 | 1275 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-13 02:30:24 has no hits.
BS17205.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:13:47 Download gff for
BS17205.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17343-PA | 1..255 | 17..271 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 21:47:13 Download gff for
BS17205.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10702-RD | 3626..3880 | 17..271 | 100 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 06:32:05 Download gff for
BS17205.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17343-RA | 65..319 | 17..271 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 06:32:05 Download gff for
BS17205.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 19064993..19065247 | 17..271 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 21:47:13 Download gff for
BS17205.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 19064993..19065247 | 17..271 | 100 | | Plus |
BS17205.pep Sequence
Translation from 16 to 270
> BS17205.pep
MRRRELQTIQLKLSDLKEYEQAKMERLRNRQQLLTPRTPTPPSDSEVLPA
TSSSVPAVLLASGKNLDDDADKSEPTTKPSTSST*
BS17205.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:06:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17343-PA | 84 | CG17343-PA | 1..84 | 1..84 | 416 | 100 | Plus |