Clone BS17222 Report

Search the DGRC for BS17222

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:172
Well:22
Vector:pDNR-Dual
Associated Gene/TranscriptCG14113-RA
Protein status:BS17222.pep: full length peptide match
Sequenced Size:281

Clone Sequence Records

BS17222.complete Sequence

281 bp assembled on 2010-02-09

GenBank Submission: KX806415

> BS17222.complete
GAAGTTATCAGTCGACATGTCATCCGAAGAAGAGGTATACACGGAGGAGG
AGACTGATCAGGCCATGTCCTTCATTCGTGAGCATGACCTGCCCATGTCG
GAGCTGCAGTATGCACTCAGATATGTCCGCATTCTGCGCGAAAACAAATC
ACTGAGCGATCAGGTTATGGGAATCCGTGAGCCACAGAATCCTGTTGCTG
AGGTGGCGCCACCGTCATTCGACTGGAATGACAAGGAGAATAAAGCCGTG
GCCCGGGATCCATAAAAGCTTTCTAGACCAT

BS17222.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:38:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG14113-RA 249 CG14113-PA 1..249 17..265 1245 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:38:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG14113-RA 513 CG14113-RA 84..332 17..265 1245 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:38:29
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13329286..13329518 33..265 1165 100 Plus
Blast to na_te.dros performed on 2014-11-28 04:38:30 has no hits.

BS17222.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:45:19 Download gff for BS17222.complete
Subject Subject Range Query Range Percent Splice Strand
CG14113-RA 1..249 17..265 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-09 18:12:45 Download gff for BS17222.complete
Subject Subject Range Query Range Percent Splice Strand
CG14113-RA 1..247 17..263 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:02:47 Download gff for BS17222.complete
Subject Subject Range Query Range Percent Splice Strand
CG14113-RA 84..330 17..263 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:45:19 Download gff for BS17222.complete
Subject Subject Range Query Range Percent Splice Strand
CG14113-RA 1..256 17..272 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:33:35 Download gff for BS17222.complete
Subject Subject Range Query Range Percent Splice Strand
CG14113-RA 84..330 17..263 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:33:35 Download gff for BS17222.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13329218..13329235 17..34 100 -> Plus
3L 13329288..13329516 35..263 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:02:47 Download gff for BS17222.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13322318..13322335 17..34 100 -> Plus
arm_3L 13322388..13322616 35..263 100   Plus

BS17222.3prime Sequence

279 bp (279 high quality bases) assembled on 2007-05-15

> BS17222.3prime
ATGGTCTAGAAAGCTTTTATGGATCCCGGGCCACGGCTTTATTCTCCTTG
TCATTCCAGTCGAATGACGGTGGCGCCACCTCAGCAACAGGATTCTGTGG
CTCACGGATTCCCATAACCTGATCGCTCAGTGATTTGTTTTCGCGCAGAA
TGCGGACATATCTGAGTGCATACTGCAGCTCCGACATGGGCAGGTCATGC
TCACGAATGAAGGACATGGCCTGATCAGTCTCCTCCTCCGTGTATACCTC
TTCTTCGGATGACATGTCGACTGATAACT

BS17222.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:20:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG14113-PA 249 CG14113-RA 1..249 265..17 1245 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 06:00:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG14113-RA 513 CG14113-RA 84..332 265..17 1245 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 06:00:21
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13329286..13329518 249..17 1165 100 Minus
Blast to na_te.dros performed on 2015-02-13 06:00:22 has no hits.

BS17222.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:20:47 Download gff for BS17222.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14113-PA 1..249 17..265 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 18:48:14 Download gff for BS17222.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14113-RA 73..339 10..277 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 08:08:05 Download gff for BS17222.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14113-RA 73..339 10..277 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 08:08:05 Download gff for BS17222.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 13329288..13329525 10..247 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 18:48:14 Download gff for BS17222.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13322388..13322625 10..247 98   Minus

BS17222.5prime Sequence

279 bp (279 high quality bases) assembled on 2007-05-15

> BS17222.5prime
GAAGTTATCAGTCGACATGTCATCCGAAGAAGAGGTATACACGGAGGAGG
AGACTGATCAGGCCATGTCCTTCATTCGTGAGCATGACCTGCCCATGTCG
GAGCTGCAGTATGCACTCAGATATGTCCGCATTCTGCGCGAAAACAAATC
ACTGAGCGATCAGGTTATGGGAATCCGTGAGCCACAGAATCCTGTTGCTG
AGGTGGCGCCACCGTCATTCGACTGGAATGACAAGGAGAATAAAGCCGTG
GCCCGGGATCCATAAAAGCTTTCTAGACC

BS17222.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:14:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG14113-PA 249 CG14113-RA 1..249 17..265 1245 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 02:26:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG14113-RA 513 CG14113-RA 84..332 17..265 1245 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 02:26:12
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13329286..13329518 33..265 1165 100 Plus
Blast to na_te.dros performed on 2015-02-11 02:26:13 has no hits.

BS17222.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:14:07 Download gff for BS17222.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14113-PA 1..249 17..265 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-22 21:00:08 Download gff for BS17222.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14113-RA 73..339 5..272 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 05:18:38 Download gff for BS17222.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14113-RA 73..339 5..272 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 05:18:38 Download gff for BS17222.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 13329288..13329525 35..272 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-22 21:00:08 Download gff for BS17222.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13322388..13322625 35..272 98   Plus

BS17222.pep Sequence

Translation from 16 to 264

> BS17222.pep
MSSEEEVYTEEETDQAMSFIREHDLPMSELQYALRYVRILRENKSLSDQV
MGIREPQNPVAEVAPPSFDWNDKENKAVARDP*

BS17222.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:51:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG14113-PA 82 CG14113-PA 1..82 1..82 423 100 Plus