Clone Sequence Records
BS17230.complete Sequence
296 bp assembled on 2010-02-09
GenBank Submission: KX804901
> BS17230.complete
GAAGTTATCAGTCGACATGATGTCCTTTGGTCGAGTTCTCGGGGGCCTAT
CCGTTTTACATTTTTCCCGGAACAGAAGTTTGCATCAAAGGAGGACGAGG
CGACCATTTCCTGTAGTTCCCGACGCGAGGATTAAGACCCCGGCGCAATC
AACCCGACCACCCCGCATCCTGGTGAAGAGCTTCTTGGCCCTCCATCATC
TGGATTCTGTGTACATGCAGGGTGCTCCTCGTGATCTTAGAGACTATTTT
ATGTCAAGCTGGAAAAACGAGAGAAAATGAAAGCTTTCTAGACCAT
BS17230.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:38:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30369-RA | 264 | CG30369-PA | 1..264 | 17..280 | 1320 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:38:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30369-RA | 499 | CG30369-RA | 121..385 | 16..280 | 1325 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:38:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 8259406..8259670 | 16..280 | 1325 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 04:38:34 has no hits.
BS17230.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:45:42 Download gff for
BS17230.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30369-RA | 1..264 | 17..280 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-09 18:12:47 Download gff for
BS17230.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30369-RA | 77..333 | 17..273 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:02:49 Download gff for
BS17230.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30369-RA | 122..378 | 17..273 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:45:42 Download gff for
BS17230.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30369-RA | 72..340 | 9..280 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:33:37 Download gff for
BS17230.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30369-RA | 122..378 | 17..273 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:33:37 Download gff for
BS17230.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8259407..8259663 | 17..273 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:02:49 Download gff for
BS17230.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 4146912..4147168 | 17..273 | 100 | | Plus |
BS17230.3prime Sequence
294 bp (294 high quality bases) assembled on 2007-05-15
> BS17230.3prime
ATGGTCTAGAAAGCTTTCATTTTCTCTCGTTTTTCCAGCTTGACATAAAA
TAGTCTCTAAGATCACGAGGAGCACCCTGCATGTACACAGAATCCAGATG
ATGGAGGGCCAAGAAGCTCTTCACCAGGATGCGGGGTGGTCGGGTTGATT
GCGCCGGGGTCTTAATCCTCGCGTCGGGAACTACAGGAAATGGTCGCCTC
GTCCTCCTTTGATGCAAACTTCTGTTCCGGGAAAAATGTAAAACGGATAG
GCCCCCGAGAACTCGACCAAAGGACATCATGTCGACTGATAACT
BS17230.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:21:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30369-PA | 264 | CG30369-RA | 1..264 | 280..17 | 1320 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 11:53:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30369-RA | 499 | CG30369-RA | 121..385 | 281..17 | 1325 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 11:53:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 8259406..8259670 | 281..17 | 1325 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-13 11:53:49 has no hits.
BS17230.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:21:29 Download gff for
BS17230.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30369-PA | 1..264 | 17..280 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 17:46:21 Download gff for
BS17230.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30369-RA | 117..385 | 17..288 | 98 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 14:17:19 Download gff for
BS17230.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30369-RA | 117..385 | 17..288 | 98 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 14:17:19 Download gff for
BS17230.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8259402..8259670 | 17..288 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 17:46:21 Download gff for
BS17230.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 4146907..4147175 | 17..288 | 98 | | Minus |
BS17230.5prime Sequence
294 bp (294 high quality bases) assembled on 2007-05-15
> BS17230.5prime
GAAGTTATCAGTCGACATGATGTCCTTTGGTCGAGTTCTCGGGGGCCTAT
CCGTTTTACATTTTTCCCGGAACAGAAGTTTGCATCAAAGGAGGACGAGG
CGACCATTTCCTGTAGTTCCCGACGCGAGGATTAAGACCCCGGCGCAATC
AACCCGACCACCCCGCATCCTGGTGAAGAGCTTCTTGGCCCTCCATCATC
TGGATTCTGTGTACATGCAGGGTGCTCCTCGTGATCTTAGAGACTATTTT
ATGTCAAGCTGGAAAAACGAGAGAAAATGAAAGCTTTCTAGACC
BS17230.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:14:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30369-PA | 264 | CG30369-RA | 1..264 | 17..280 | 1320 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 06:36:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30369-RA | 499 | CG30369-RA | 121..385 | 16..280 | 1325 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 06:36:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 8259406..8259670 | 16..280 | 1325 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-13 06:36:57 has no hits.
BS17230.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:14:45 Download gff for
BS17230.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30369-PA | 1..264 | 17..280 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 20:19:15 Download gff for
BS17230.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30369-RA | 117..385 | 9..280 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 09:13:56 Download gff for
BS17230.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30369-RA | 117..385 | 9..280 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 09:13:56 Download gff for
BS17230.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8259402..8259670 | 9..280 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 20:19:15 Download gff for
BS17230.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 4146907..4147175 | 9..280 | 98 | | Plus |
BS17230.pep Sequence
Translation from 16 to 279
> BS17230.pep
MMSFGRVLGGLSVLHFSRNRSLHQRRTRRPFPVVPDARIKTPAQSTRPPR
ILVKSFLALHHLDSVYMQGAPRDLRDYFMSSWKNERK*
BS17230.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:51:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30369-PA | 87 | CG30369-PA | 1..87 | 1..87 | 456 | 100 | Plus |