Clone BS17257 Report

Search the DGRC for BS17257

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:172
Well:57
Vector:pDNR-Dual
Associated Gene/TranscriptCG13426-RA
Protein status:BS17257.pep: full length peptide match
Sequenced Size:350

Clone Sequence Records

BS17257.complete Sequence

350 bp assembled on 2010-02-09

GenBank Submission: KX805377

> BS17257.complete
GAAGTTATCAGTCGACATGGAGCAACTACTTTCTCGTCGCCGCAGATACA
GGGCCAAATGTGCCAAGAGGAGTGTCCGCAAATTCTTACCCGATTTGAAG
TGCAAGTCTGTGGAACGCATTAAATGCCAGATTAAGGATCTGCTGATCTT
AATGGTTCCGTCCAAGGATTTCTATAAGAACTCGTTGCGGTTCTACAAGC
GCTGCACAAAACCAGATCGTCGGGAGTTCCAGCGTATCAGCATTGGCATT
GGCGTAGGATTCCTTATCATGGGCTTGATTGGATTCGTCGTTAAGCTGAT
GCACATACCCATAGTCAACATCATCATGGACTGAAAGCTTTCTAGACCAT

BS17257.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:42:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG13426-RA 318 CG13426-PA 1..318 17..334 1590 100 Plus
CG8860-RA 207 CG8860-PA 67..199 197..329 200 76.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:42:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG13426-RA 418 CG13426-RA 58..375 17..334 1590 100 Plus
CG8860-RA 420 CG8860-RA 176..308 197..329 200 76.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:42:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20512740..20513006 334..68 1335 100 Minus
2R 25286936 2R 20513059..20513112 70..17 270 100 Minus
2R 25286936 2R 12179595..12179727 329..197 200 76.7 Minus
Blast to na_te.dros performed on 2014-11-28 04:42:45 has no hits.

BS17257.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:14:03 Download gff for BS17257.complete
Subject Subject Range Query Range Percent Splice Strand
CG13426-RA 1..318 17..334 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-09 18:13:11 Download gff for BS17257.complete
Subject Subject Range Query Range Percent Splice Strand
CG13426-RA 58..374 17..333 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:03:40 Download gff for BS17257.complete
Subject Subject Range Query Range Percent Splice Strand
CG13426-RA 58..374 17..333 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:14:03 Download gff for BS17257.complete
Subject Subject Range Query Range Percent Splice Strand
CG13426-RA 58..380 17..339 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:35:19 Download gff for BS17257.complete
Subject Subject Range Query Range Percent Splice Strand
CG13426-RA 58..374 17..333 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:35:19 Download gff for BS17257.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20512741..20513004 70..333 100 <- Minus
2R 20513060..20513112 17..69 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:03:40 Download gff for BS17257.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16400246..16400509 70..333 100 <- Minus
arm_2R 16400565..16400617 17..69 100   Minus

BS17257.5prime Sequence

348 bp (348 high quality bases) assembled on 2007-05-15

> BS17257.5prime
GAAGTTATCAGTCGACATGGAGCAACTACTTTCTCGTCGCCGCAGATACA
GGGCCAAATGTGCCAAGAGGAGTGTCCGCAAATTCTTACCCGATTTGAAG
TGCAAGTCTGTGGAACGCATTAAATGCCAGATTAAGGATCTGCTGATCTT
AATGGTTCCGTCCAAGGATTTCTATAAGAACTCGTTGCGGTTCTACAAGC
GCTGCACAAAACCAGATCGTCGGGAGTTCCAGCGTATCAGCATTGGCATT
GGCGTAGGATTCCTTATCATGGGCTTGATTGGATTCGTCGTTAAGCTGAT
GCACATACCCATAGTCAACATCATCATGGACTGAAAGCTTTCTAGACC

BS17257.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:12:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG13426-PA 318 CG13426-RA 1..318 17..334 1590 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 13:04:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG13426-RA 418 CG13426-RA 58..375 17..334 1590 100 Plus
CG8860-RA 420 CG8860-RA 176..308 197..329 200 76.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 13:04:40
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20512740..20513006 334..68 1335 100 Minus
2R 25286936 2R 20513059..20513112 70..17 270 100 Minus
2R 25286936 2R 12179595..12179727 329..197 200 76.7 Minus
Blast to na_te.dros performed on 2015-02-13 13:04:41 has no hits.

BS17257.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:12:20 Download gff for BS17257.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13426-PA 1..318 17..334 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 17:39:45 Download gff for BS17257.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13426-RA 58..380 17..339 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 15:38:08 Download gff for BS17257.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13426-RA 58..380 17..339 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 15:38:08 Download gff for BS17257.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 20512735..20513004 70..339 99 <- Minus
2R 20513060..20513112 17..69 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 17:39:45 Download gff for BS17257.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16400240..16400509 70..339 99 <- Minus
arm_2R 16400565..16400617 17..69 100 <- Minus

BS17257.3prime Sequence

348 bp (348 high quality bases) assembled on 2007-05-15

> BS17257.3prime
ATGGTCTAGAAAGCTTTCACTCCATGATGATGTTGACTATGGGTATGTGC
ATCAGCTTAACGACGAATCCAATCAAGCCCATGATAAGGAATCCTACGCC
AATGCCAATGCTGATACGCTGGAACTCCCGACGATCTGGTTTTGTGCAGC
GCTTGTAGAACCGCAACGAGTTCTTATAGAAATCCTTGGACGGAACCATT
AAGATCAGCAGATCCTTAATCTGGCATTTAATGCGTTCCACAGACTTGCA
CTTCAAATCGGGTAAGAATTTGCGGACACTCCTCTTGGCACATTTGGCCC
TGTATCTGCGGCGACGAGAAAGTAGTTGCTCCATGTCGACTGATAACT

BS17257.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:18:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG13426-PA 318 CG13426-RA 1..314 334..21 1570 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 23:39:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG13426-RA 418 CG13426-RA 58..375 334..17 1575 99.7 Minus
CG8860-RA 420 CG8860-RA 176..308 154..22 200 76.7 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 23:39:24
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20512740..20513006 17..283 1320 99.6 Plus
2R 25286936 2R 20513059..20513112 281..334 270 100 Plus
2R 25286936 2R 12179595..12179727 22..154 200 76.7 Plus
Blast to na_te.dros performed on 2015-02-12 23:39:26 has no hits.

BS17257.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:18:55 Download gff for BS17257.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13426-PA 1..318 17..334 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 21:49:21 Download gff for BS17257.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13426-RA 58..380 12..334 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 02:13:48 Download gff for BS17257.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13426-RA 58..380 12..334 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 02:13:48 Download gff for BS17257.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 20512735..20513004 12..281 98 <- Plus
2R 20513060..20513112 282..334 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 21:49:21 Download gff for BS17257.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16400240..16400509 12..281 98 <- Plus
arm_2R 16400565..16400617 282..334 100 <- Plus

BS17257.pep Sequence

Translation from 16 to 333

> BS17257.pep
MEQLLSRRRRYRAKCAKRSVRKFLPDLKCKSVERIKCQIKDLLILMVPSK
DFYKNSLRFYKRCTKPDRREFQRISIGIGVGFLIMGLIGFVVKLMHIPIV
NIIMD*

BS17257.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:56:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG13426-PA 105 CG13426-PA 1..105 1..105 538 100 Plus
Sec61gamma-PC 68 CG14214-PC 10..66 48..104 196 64.9 Plus
Sec61gamma-PB 68 CG14214-PB 10..66 48..104 196 64.9 Plus
Sec61gamma-PA 68 CG14214-PA 10..66 48..104 196 64.9 Plus
CG8860-PA 68 CG8860-PA 10..66 48..104 196 64.9 Plus