Clone BS17316 Report

Search the DGRC for BS17316

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:173
Well:16
Vector:pDNR-Dual
Associated Gene/TranscriptCG12784-RA
Protein status:BS17316.pep: full length peptide match
Sequenced Size:338

Clone Sequence Records

BS17316.complete Sequence

338 bp assembled on 2010-02-09

GenBank Submission: KX801426

> BS17316.complete
GAAGTTATCAGTCGACATGGATTTCGGTGAAAACGTGTTTGACCGTTTGG
ATGCGTGGACTAAAAGTGAAGTGAAGCCCGGTGAAATGGGACGCATCTTG
GCCGTTCTTCTGACCCTGATAGTGATCAGCTTTGCCATTGTCGTTGTGGC
TCGCATCCTGGTATCTCTGGCCATACCAACATTGGTTATTGTGGCACTTT
TGATGGCATACCGTTTCGTCACTCTTTCGGAAATGAAAGATGGTCTCATG
GCTGTGCCCGATATTCTAACATCGTGTACGAACTTTATATCTGGCCTTTT
TTGCCAGTTGAAGGCAAAGTAAAAGCTTTCTAGACCAT

BS17316.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:40:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG12784-RA 306 CG12784-PA 1..306 17..322 1530 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:40:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG12784-RA 437 CG12784-RA 55..362 17..324 1540 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:40:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15763169..15763476 17..324 1540 100 Plus
Blast to na_te.dros performed 2014-11-28 04:40:14
Subject Length Description Subject Range Query Range Score Percent Strand
transib2 2844 transib2 TRANSIB2 2844bp 2260..2303 36..81 108 73.9 Plus

BS17316.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:01:14 Download gff for BS17316.complete
Subject Subject Range Query Range Percent Splice Strand
CG12784-RA 1..306 17..322 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-09 18:13:01 Download gff for BS17316.complete
Subject Subject Range Query Range Percent Splice Strand
CG12784-RA 55..358 17..320 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:03:13 Download gff for BS17316.complete
Subject Subject Range Query Range Percent Splice Strand
CG12784-RA 55..358 17..320 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:01:14 Download gff for BS17316.complete
Subject Subject Range Query Range Percent Splice Strand
CG12784-RA 52..366 14..331 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:34:17 Download gff for BS17316.complete
Subject Subject Range Query Range Percent Splice Strand
CG12784-RA 55..358 17..320 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:34:17 Download gff for BS17316.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15763169..15763472 17..320 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:03:13 Download gff for BS17316.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11588891..11589194 17..320 100   Plus

BS17316.3prime Sequence

336 bp (336 high quality bases) assembled on 2007-05-15

> BS17316.3prime
ATGGTCTAGAAAGCTTTTACTTTGCCTTCAACTGGCAAAAAAGGCCAGAT
ATAAAGTTCGTACACGATGTTAGAATATCGGGCACAGCCATGAGACCATC
TTTCATTTCCGAAAGAGTGACGAAACGGTATGCCATCAAAAGTGCCACAA
TAACCAATGTTGGTATGGCCAGAGATACCAGGATGCGAGCCACAACGACA
ATGGCAAAGCTGATCACTATCAGGGTCAGAAGAACGGCCAAGATGCGTCC
CATTTCACCGGGCTTCACTTCACTTTTAGTCCACGCATCCAAACGGTCAA
ACACGTTTTCACCGAAATCCATGTCGACTGATAACT

BS17316.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:35:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG12784-PA 306 CG12784-RA 1..306 322..17 1530 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:10:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG12784-RA 437 CG12784-RA 55..362 322..15 1540 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:10:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15763169..15763476 322..15 1540 100 Minus
Blast to na_te.dros performed 2015-02-12 10:10:49
Subject Length Description Subject Range Query Range Score Percent Strand
transib2 2844 transib2 TRANSIB2 2844bp 2260..2303 303..258 108 73.9 Minus

BS17316.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:35:05 Download gff for BS17316.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12784-PA 1..306 17..322 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 20:54:00 Download gff for BS17316.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12784-RA 52..366 8..325 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 12:49:37 Download gff for BS17316.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12784-RA 52..366 8..325 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 12:49:37 Download gff for BS17316.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 15763166..15763480 8..325 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 20:54:00 Download gff for BS17316.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11588888..11589202 8..325 98   Minus

BS17316.5prime Sequence

336 bp (336 high quality bases) assembled on 2007-05-15

> BS17316.5prime
GAAGTTATCAGTCGACATGGATTTCGGTGAAAACGTGTTTGACCGTTTGG
ATGCGTGGACTAAAAGTGAAGTGAAGCCCGGTGAAATGGGACGCATCTTG
GCCGTTCTTCTGACCCTGATAGTGATCAGCTTTGCCATTGTCGTTGTGGC
TCGCATCCTGGTATCTCTGGCCATACCAACATTGGTTATTGTGGCACTTT
TGATGGCATACCGTTTCGTCACTCTTTCGGAAATGAAAGATGGTCTCATG
GCTGTGCCCGATATTCTAACATCGTGTACGAACTTTATATCTGGCCTTTT
TTGCCAGTTGAAGGCAAAGTAAAAGCTTTCTAGACC

BS17316.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:27:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG12784-PA 306 CG12784-RA 1..306 17..322 1530 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 15:20:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG12784-RA 437 CG12784-RA 55..362 17..324 1540 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 15:20:03
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15763169..15763476 17..324 1540 100 Plus
Blast to na_te.dros performed 2015-02-10 15:20:07
Subject Length Description Subject Range Query Range Score Percent Strand
transib2 2844 transib2 TRANSIB2 2844bp 2260..2303 36..81 108 73.9 Plus

BS17316.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:27:42 Download gff for BS17316.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12784-PA 1..306 17..322 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-15 06:21:36 Download gff for BS17316.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12784-RA 52..366 14..331 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:18:35 Download gff for BS17316.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12784-RA 52..366 14..331 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:18:35 Download gff for BS17316.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 15763166..15763480 14..331 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-15 06:21:36 Download gff for BS17316.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11588888..11589202 14..331 98   Plus

BS17316.pep Sequence

Translation from 16 to 321

> BS17316.pep
MDFGENVFDRLDAWTKSEVKPGEMGRILAVLLTLIVISFAIVVVARILVS
LAIPTLVIVALLMAYRFVTLSEMKDGLMAVPDILTSCTNFISGLFCQLKA
K*

BS17316.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:52:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG12784-PA 101 CG12784-PA 1..101 1..101 494 100 Plus