Clone BS17352 Report

Search the DGRC for BS17352

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:173
Well:52
Vector:pDNR-Dual
Associated Gene/TranscriptCG10834-RA
Protein status:BS17352.pep: full length peptide match
Sequenced Size:326

Clone Sequence Records

BS17352.complete Sequence

326 bp assembled on 2010-02-09

GenBank Submission: KX801019

> BS17352.complete
GAAGTTATCAGTCGACATGTCCGCGGAAATCGAGGATTTGCTGAAACGCT
ATCAAAACTACCCCAATGTTTCTGGCATAATTATTTTGGACCCGTTCGCT
ATACCAATCAAGACCACCATGGAGTACACCTTGACCGTGCATTACGCGGC
CTTGATCAGCACCTTAACTTATAAGGCGGCCAAAATGATTACCAATTTGG
ATGCCAGCAATGAGCTGGTGACAATACGTCTGCGCACCAAGGTTCACGAG
GTGATTGTGCTGCCCTCCGAGAACTACATCATTATTGTAGTGCAAAATCC
AGGCACCTAAAAGCTTTCTAGACCAT

BS17352.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:39:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG10834-RA 294 CG10834-PA 1..294 17..310 1470 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:39:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG10834-RA 443 CG10834-RA 61..355 17..311 1475 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:39:52
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 22106950..22107244 311..17 1475 100 Minus
Blast to na_te.dros performed on 2014-11-28 04:39:52 has no hits.

BS17352.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:59:12 Download gff for BS17352.complete
Subject Subject Range Query Range Percent Splice Strand
CG10834-RA 1..294 17..310 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-09 18:12:57 Download gff for BS17352.complete
Subject Subject Range Query Range Percent Splice Strand
CG10834-RA 36..327 17..308 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:03:08 Download gff for BS17352.complete
Subject Subject Range Query Range Percent Splice Strand
CG10834-RA 36..327 17..308 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:59:12 Download gff for BS17352.complete
Subject Subject Range Query Range Percent Splice Strand
CG10834-RA 36..338 17..320 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:34:08 Download gff for BS17352.complete
Subject Subject Range Query Range Percent Splice Strand
CG10834-RA 61..352 17..308 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:34:08 Download gff for BS17352.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22106953..22107244 17..308 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:03:08 Download gff for BS17352.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 22106953..22107244 17..308 100   Minus

BS17352.3prime Sequence

324 bp (324 high quality bases) assembled on 2007-05-15

> BS17352.3prime
ATGGTCTAGAAAGCTTTTAGGTGCCTGGATTTTGCACTACAATAATGATG
TAGTTCTCGGAGGGCAGCACAATCACCTCGTGAACCTTGGTGCGCAGACG
TATTGTCACCAGCTCATTGCTGGCATCCAAATTGGTAATCATTTTGGCCG
CCTTATAAGTTAAGGTGCTGATCAAGGCCGCGTAATGCACGGTCAAGGTG
TACTCCATGGTGGTCTTGATTGGTATAGCGAACGGGTCCAAAATAATTAT
GCCAGAAACATTGGGGTAGTTTTGATAGCGTTTCAGCAAATCCTCGATTT
CCGCGGACATGTCGACTGATAACT

BS17352.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:36:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG10834-PA 294 CG10834-RA 1..294 310..17 1470 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 05:11:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG10834-RA 443 CG10834-RA 61..355 310..16 1475 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 05:11:42
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 22106950..22107244 16..310 1475 100 Plus
Blast to na_te.dros performed on 2015-02-12 05:11:44 has no hits.

BS17352.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:36:27 Download gff for BS17352.3prime
Subject Subject Range Query Range Percent Splice Strand
CG10834-PA 1..294 17..310 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 05:40:56 Download gff for BS17352.3prime
Subject Subject Range Query Range Percent Splice Strand
CG10834-RA 36..338 7..310 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:29:54 Download gff for BS17352.3prime
Subject Subject Range Query Range Percent Splice Strand
CG10834-RA 61..363 7..310 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:29:54 Download gff for BS17352.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 22106942..22107244 7..310 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 05:40:56 Download gff for BS17352.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 22106942..22107244 7..310 98   Plus

BS17352.5prime Sequence

324 bp (324 high quality bases) assembled on 2007-05-15

> BS17352.5prime
GAAGTTATCAGTCGACATGTCCGCGGAAATCGAGGATTTGCTGAAACGCT
ATCAAAACTACCCCAATGTTTCTGGCATAATTATTTTGGACCCGTTCGCT
ATACCAATCAAGACCACCATGGAGTACACCTTGACCGTGCATTACGCGGC
CTTGATCAGCACCTTAACTTATAAGGCGGCCAAAATGATTACCAATTTGG
ATGCCAGCAATGAGCTGGTGACAATACGTCTGCGCACCAAGGTTCACGAG
GTGATTGTGCTGCCCTCCGAGAACTACATCATTATTGTAGTGCAAAATCC
AGGCACCTAAAAGCTTTCTAGACC

BS17352.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:29:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG10834-PA 294 CG10834-RA 1..294 17..310 1470 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:29:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG10834-RA 443 CG10834-RA 61..355 17..311 1475 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:29:43
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 22106950..22107244 311..17 1475 100 Minus
Blast to na_te.dros performed on 2015-02-10 21:29:47 has no hits.

BS17352.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:29:09 Download gff for BS17352.5prime
Subject Subject Range Query Range Percent Splice Strand
CG10834-PA 1..294 17..310 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 11:14:31 Download gff for BS17352.5prime
Subject Subject Range Query Range Percent Splice Strand
CG10834-RA 36..338 17..320 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:58:59 Download gff for BS17352.5prime
Subject Subject Range Query Range Percent Splice Strand
CG10834-RA 61..363 17..320 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:58:59 Download gff for BS17352.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 22106942..22107244 17..320 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 11:14:31 Download gff for BS17352.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 22106942..22107244 17..320 98   Minus

BS17352.pep Sequence

Translation from 16 to 309

> BS17352.pep
MSAEIEDLLKRYQNYPNVSGIIILDPFAIPIKTTMEYTLTVHYAALISTL
TYKAAKMITNLDASNELVTIRLRTKVHEVIVLPSENYIIIVVQNPGT*

BS17352.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:52:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG10834-PA 97 CG10834-PA 1..97 1..97 482 100 Plus
robl22E-PB 97 CG10838-PB 1..95 1..95 282 53.7 Plus
robl22E-PA 97 CG10838-PA 1..95 1..95 282 53.7 Plus
robl-PA 97 CG10751-PA 1..95 1..95 230 44.2 Plus
CG10822-PA 114 CG10822-PA 15..104 5..94 159 31.1 Plus