Clone BS17368 Report

Search the DGRC for BS17368

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:173
Well:68
Vector:pDNR-Dual
Associated Gene/TranscriptCG17856-RA
Protein status:BS17368.pep: full length peptide match
Sequenced Size:368

Clone Sequence Records

BS17368.complete Sequence

368 bp assembled on 2010-02-09

GenBank Submission: KX801851

> BS17368.complete
GAAGTTATCAGTCGACATGTCGAAATATGTGGCTAGAGTGGGCCCAGCGG
TTTTCTCCAAGTTGGGAAAGTGGGCCTACAACATGTCTGGATTCAACCAA
TACGGCCTGTATCGCGATGACTGTCTGTACGAGAATGAGGATGTGGCAGA
AGCAGTGCGTCGTCTGCCCCGCAAACTGTACGATGAACGCAACTATCGCA
TTCTTCGAGCACTGCACCTTTCCATGACCAAGACGATCCTGCCCAAGGAG
CAGTGGACCAAGTACGAGGAGGACATCAAGTACTTGGAGCCCTATCTTAA
CGAAGTGCAAAAGGAGCGCGAAGAGCGTGAGGAATGGAGCAAAACTCATT
GAAAGCTTTCTAGACCAT

BS17368.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:39:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG17856-RA 336 CG17856-PA 1..336 17..352 1680 100 Plus
CG3560-RA 336 CG3560-PA 1..321 17..337 645 80.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:39:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG17856-RA 503 CG17856-RA 86..422 16..352 1685 100 Plus
CG3560-RA 523 CG3560-RA 122..443 16..337 650 80.1 Plus
CG32576-RA 1709 CG32576-RA 754..984 337..107 510 81.4 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:39:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 28294133..28294469 16..352 1685 100 Plus
X 23542271 X 16286678..16286908 107..337 510 81.4 Plus
Blast to na_te.dros performed 2014-11-28 04:39:43
Subject Length Description Subject Range Query Range Score Percent Strand
accord2 7650 accord2 QBERT 7650bp 4959..5027 319..249 106 66.7 Minus

BS17368.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:59:04 Download gff for BS17368.complete
Subject Subject Range Query Range Percent Splice Strand
CG17856-RA 1..336 17..352 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-09 18:12:56 Download gff for BS17368.complete
Subject Subject Range Query Range Percent Splice Strand
CG17856-RA 1..335 17..351 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:03:05 Download gff for BS17368.complete
Subject Subject Range Query Range Percent Splice Strand
CG17856-RA 87..421 17..351 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:59:04 Download gff for BS17368.complete
Subject Subject Range Query Range Percent Splice Strand
CG17856-RA 1..336 17..352 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:34:04 Download gff for BS17368.complete
Subject Subject Range Query Range Percent Splice Strand
CG17856-RA 87..421 17..351 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:34:04 Download gff for BS17368.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28294134..28294468 17..351 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:03:05 Download gff for BS17368.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 24119856..24120190 17..351 100   Plus

BS17368.3prime Sequence

366 bp (366 high quality bases) assembled on 2007-05-15

> BS17368.3prime
ATGGTCTAGAAAGCTTTCAATGAGTTTTGCTCCATTCCTCACGCTCTTCG
CGCTCCTTTTGCACTTCGTTAAGATAGGGCTCCAAGTACTTGATGTCCTC
CTCGTACTTGGTCCACTGCTCCTTGGGCAGGATCGTCTTGGTCATGGAAA
GGTGCAGTGCTCGAAGAATGCGATAGTTGCGTTCATCGTACAGTTTGCGG
GGCAGACGACGCACTGCTTCTGCCACATCCTCATTCTCGTACAGACAGTC
ATCGCGATACAGGCCGTATTGGTTGAATCCAGACATGTTGTAGGCCCACT
TTCCCAACTTGGAGAAAACCGCTGGGCCCACTCTAGCCACATATTTCGAC
ATGTCGACTGATAACT

BS17368.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:33:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG17856-PA 336 CG17856-RA 1..336 352..17 1680 100 Minus
CG3560-PA 336 CG3560-RA 205..266 148..87 235 95.1 Minus
CG3560-PA 336 CG3560-RA 73..129 280..224 160 91.2 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 02:52:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG17856-RA 503 CG17856-RA 86..422 353..17 1685 100 Minus
CG3560-RA 523 CG3560-RA 122..443 353..32 650 80.1 Minus
CG32576-RA 1709 CG32576-RA 754..984 32..262 510 81.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 02:52:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 28294133..28294469 353..17 1685 100 Minus
X 23542271 X 16286678..16286908 262..32 510 81.4 Minus
Blast to na_te.dros performed 2015-02-11 02:52:25
Subject Length Description Subject Range Query Range Score Percent Strand
accord2 7650 accord2 QBERT 7650bp 4959..5027 50..120 106 66.7 Plus

BS17368.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:33:33 Download gff for BS17368.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17856-PA 1..336 17..352 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-22 21:02:18 Download gff for BS17368.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17856-RA 86..422 17..353 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 05:20:10 Download gff for BS17368.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17856-RA 86..422 17..353 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 05:20:10 Download gff for BS17368.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 28294133..28294469 17..353 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-22 21:02:18 Download gff for BS17368.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 24119855..24120191 17..353 100   Minus

BS17368.5prime Sequence

366 bp (366 high quality bases) assembled on 2007-05-15

> BS17368.5prime
GAAGTTATCAGTCGACATGTCGAAATATGTGGCTAGAGTGGGCCCAGCGG
TTTTCTCCAAGTTGGGAAAGTGGGCCTACAACATGTCTGGATTCAACCAA
TACGGCCTGTATCGCGATGACTGTCTGTACGAGAATGAGGATGTGGCAGA
AGCAGTGCGTCGTCTGCCCCGCAAACTGTACGATGAACGCAACTATCGCA
TTCTTCGAGCACTGCACCTTTCCATGACCAAGACGATCCTGCCCAAGGAG
CAGTGGACCAAGTACGAGGAGGACATCAAGTACTTGGAGCCCTATCTTAA
CGAAGTGCAAAAGGAGCGCGAAGAGCGTGAGGAATGGAGCAAAACTCATT
GAAAGCTTTCTAGACC

BS17368.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:26:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG17856-PA 336 CG17856-RA 1..336 17..352 1680 100 Plus
CG3560-PA 336 CG3560-RA 205..266 221..282 235 95.1 Plus
CG3560-PA 336 CG3560-RA 73..129 89..145 160 91.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 15:15:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG17856-RA 503 CG17856-RA 86..422 16..352 1685 100 Plus
CG3560-RA 523 CG3560-RA 122..443 16..337 650 80.1 Plus
CG32576-RA 1709 CG32576-RA 754..984 337..107 510 81.4 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 15:15:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 28294133..28294469 16..352 1685 100 Plus
X 23542271 X 16286678..16286908 107..337 510 81.4 Plus
Blast to na_te.dros performed 2015-02-13 15:15:38
Subject Length Description Subject Range Query Range Score Percent Strand
accord2 7650 accord2 QBERT 7650bp 4959..5027 319..249 106 66.7 Minus

BS17368.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:26:08 Download gff for BS17368.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17856-PA 1..336 17..352 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 11:50:45 Download gff for BS17368.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17856-RA 86..422 16..352 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 17:01:36 Download gff for BS17368.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17856-RA 86..422 16..352 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 17:01:36 Download gff for BS17368.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 28294133..28294469 16..352 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 11:50:45 Download gff for BS17368.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 24119855..24120191 16..352 100   Plus

BS17368.pep Sequence

Translation from 16 to 351

> BS17368.pep
MSKYVARVGPAVFSKLGKWAYNMSGFNQYGLYRDDCLYENEDVAEAVRRL
PRKLYDERNYRILRALHLSMTKTILPKEQWTKYEEDIKYLEPYLNEVQKE
REEREEWSKTH*

BS17368.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:51:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG17856-PA 111 CG17856-PA 1..111 1..111 596 100 Plus
CG3560-PA 111 CG3560-PA 1..111 1..111 528 85.6 Plus