Clone Sequence Records
BS17373.complete Sequence
293 bp assembled on 2010-02-09
GenBank Submission: KX806177
> BS17373.complete
GAAGTTATCAGTCGACATGGCGTTTAATAGCCGGGTTTTGGTGCCTGTCC
TCAAGGCCGATGATGACGAAAAGGAGTTAGTTGATCCGCAAGCAGCCCTT
AGGGAGAAGTGCCAGGCCAAAGGTCACATTGCGTCCCTGTACAACAAGTA
TCAAGAGTGCAATGATCGTGTGAATGGCAAGTCCAAAACCACTGAGACAT
GCATGGAGGAATTGTTCGACTTCGTCGCTGAATTGGATCATTGCGTTGCT
CACAGTCTCTTCTCGAAACTCAAATAGAAGCTTTCTAGACCAT
BS17373.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 03:12:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30354-RB | 261 | CG30354-PB | 1..261 | 17..277 | 1305 | 100 | Plus |
CG30354-RA | 261 | CG30354-PA | 1..261 | 17..277 | 1305 | 100 | Plus |
Ucrh-RD | 258 | CG41623-PD | 42..239 | 61..258 | 435 | 81.3 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:12:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30354-RB | 443 | CG30354-RB | 117..377 | 17..277 | 1305 | 100 | Plus |
CG30354-RA | 387 | CG30354-RA | 61..321 | 17..277 | 1305 | 100 | Plus |
Ucrh-RD | 506 | CG41623-RD | 136..333 | 61..258 | 435 | 81.3 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 03:12:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 8677335..8677595 | 17..277 | 1305 | 100 | Plus |
3L | 28110227 | 3L | 25121043..25121198 | 103..258 | 345 | 81.4 | Plus |
Blast to na_te.dros performed on 2014-11-28 03:12:57 has no hits.
BS17373.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:46:14 Download gff for
BS17373.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30354-RA | 1..261 | 17..277 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-09 18:16:40 Download gff for
BS17373.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30354-RA | 9..263 | 17..271 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:38:20 Download gff for
BS17373.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30354-RA | 61..315 | 17..271 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:46:14 Download gff for
BS17373.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30354-RA | 5..273 | 10..285 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:45:21 Download gff for
BS17373.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30354-RA | 61..315 | 17..271 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:45:21 Download gff for
BS17373.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8677335..8677589 | 17..271 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:38:20 Download gff for
BS17373.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 4564840..4565094 | 17..271 | 100 | | Plus |
BS17373.3prime Sequence
291 bp (291 high quality bases) assembled on 2007-05-15
> BS17373.3prime
ATGGTCTAGAAAGCTTCTATTTGAGTTTCGAGAAGAGACTGTGAGCAACG
CAATGATCCAATTCAGCGACGAAGTCGAACAATTCCTCCATGCATGTCTC
AGTGGTTTTGGACTTGCCATTCACACGATCATTGCACTCTTGATACTTGT
TGTACAGGGACGCAATGTGACCTTTGGCCTGGCACTTCTCCCTAAGGGCT
GCTTGCGGATCAACTAACTCCTTTTCGTCATCATCGGCCTTGAGGACAGG
CACCAAAACCCGGCTATTAAACGCCATGTCGACTGATAACT
BS17373.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:33:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30354-PA | 261 | CG30354-RA | 1..261 | 277..17 | 1305 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:09:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30354-RB | 443 | CG30354-RB | 117..377 | 277..17 | 1305 | 100 | Minus |
CG30354-RA | 387 | CG30354-RA | 61..321 | 277..17 | 1305 | 100 | Minus |
Ucrh-RD | 506 | CG41623-RD | 136..333 | 233..36 | 435 | 81.9 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:09:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 8677335..8677595 | 277..17 | 1305 | 100 | Minus |
3L | 28110227 | 3L | 25121043..25121198 | 191..36 | 345 | 81.4 | Minus |
Blast to na_te.dros performed on 2015-02-12 10:09:36 has no hits.
BS17373.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:33:46 Download gff for
BS17373.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30354-PA | 1..261 | 17..277 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 20:53:39 Download gff for
BS17373.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30354-RA | 57..325 | 9..284 | 97 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:09:31 Download gff for
BS17373.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30354-RA | 57..325 | 9..284 | 97 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:09:31 Download gff for
BS17373.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8677331..8677594 | 18..284 | 98 | -> | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 20:53:39 Download gff for
BS17373.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 4564836..4565099 | 18..284 | 98 | -> | Minus |
BS17373.5prime Sequence
291 bp (291 high quality bases) assembled on 2007-05-15
> BS17373.5prime
GAAGTTATCAGTCGACATGGCGTTTAATAGCCGGGTTTTGGTGCCTGTCC
TCAAGGCCGATGATGACGAAAAGGAGTTAGTTGATCCGCAAGCAGCCCTT
AGGGAGAAGTGCCAGGCCAAAGGTCACATTGCGTCCCTGTACAACAAGTA
TCAAGAGTGCAATGATCGTGTGAATGGCAAGTCCAAAACCACTGAGACAT
GCATGGAGGAATTGTTCGACTTCGTCGCTGAATTGGATCATTGCGTTGCT
CACAGTCTCTTCTCGAAACTCAAATAGAAGCTTTCTAGACC
BS17373.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:26:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30354-PA | 261 | CG30354-RA | 1..261 | 17..277 | 1305 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 15:15:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30354-RB | 443 | CG30354-RB | 117..377 | 17..277 | 1305 | 100 | Plus |
CG30354-RA | 387 | CG30354-RA | 61..321 | 17..277 | 1305 | 100 | Plus |
Ucrh-RD | 506 | CG41623-RD | 136..333 | 61..258 | 435 | 81.9 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 15:15:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 8677335..8677595 | 17..277 | 1305 | 100 | Plus |
3L | 28110227 | 3L | 25121043..25121198 | 103..258 | 345 | 81.4 | Plus |
Blast to na_te.dros performed on 2015-02-10 15:15:40 has no hits.
BS17373.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:26:21 Download gff for
BS17373.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30354-PA | 1..261 | 17..277 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-15 06:21:02 Download gff for
BS17373.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30354-RA | 57..325 | 10..285 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:17:19 Download gff for
BS17373.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30354-RA | 57..325 | 10..285 | 97 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:17:19 Download gff for
BS17373.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8677331..8677594 | 10..276 | 98 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-15 06:21:02 Download gff for
BS17373.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 4564836..4565099 | 10..276 | 98 | -> | Plus |
BS17373.pep Sequence
Translation from 16 to 276
> BS17373.pep
MAFNSRVLVPVLKADDDEKELVDPQAALREKCQAKGHIASLYNKYQECND
RVNGKSKTTETCMEELFDFVAELDHCVAHSLFSKLK*
BS17373.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:50:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30354-PB | 86 | CG30354-PB | 1..86 | 1..86 | 450 | 100 | Plus |
CG30354-PA | 86 | CG30354-PA | 1..86 | 1..86 | 450 | 100 | Plus |
Ucrh-PD | 85 | CG41623-PD | 1..85 | 1..86 | 360 | 77.9 | Plus |
Ucrh-PC | 85 | CG41623-PC | 1..85 | 1..86 | 360 | 77.9 | Plus |
Ucrh-PB | 85 | CG41623-PB | 1..85 | 1..86 | 360 | 77.9 | Plus |