Clone BS17373 Report

Search the DGRC for BS17373

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:173
Well:73
Vector:pDNR-Dual
Associated Gene/TranscriptCG30354-RA
Protein status:BS17373.pep: full length peptide match
Sequenced Size:293

Clone Sequence Records

BS17373.complete Sequence

293 bp assembled on 2010-02-09

GenBank Submission: KX806177

> BS17373.complete
GAAGTTATCAGTCGACATGGCGTTTAATAGCCGGGTTTTGGTGCCTGTCC
TCAAGGCCGATGATGACGAAAAGGAGTTAGTTGATCCGCAAGCAGCCCTT
AGGGAGAAGTGCCAGGCCAAAGGTCACATTGCGTCCCTGTACAACAAGTA
TCAAGAGTGCAATGATCGTGTGAATGGCAAGTCCAAAACCACTGAGACAT
GCATGGAGGAATTGTTCGACTTCGTCGCTGAATTGGATCATTGCGTTGCT
CACAGTCTCTTCTCGAAACTCAAATAGAAGCTTTCTAGACCAT

BS17373.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 03:12:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG30354-RB 261 CG30354-PB 1..261 17..277 1305 100 Plus
CG30354-RA 261 CG30354-PA 1..261 17..277 1305 100 Plus
Ucrh-RD 258 CG41623-PD 42..239 61..258 435 81.3 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:12:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG30354-RB 443 CG30354-RB 117..377 17..277 1305 100 Plus
CG30354-RA 387 CG30354-RA 61..321 17..277 1305 100 Plus
Ucrh-RD 506 CG41623-RD 136..333 61..258 435 81.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 03:12:56
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8677335..8677595 17..277 1305 100 Plus
3L 28110227 3L 25121043..25121198 103..258 345 81.4 Plus
Blast to na_te.dros performed on 2014-11-28 03:12:57 has no hits.

BS17373.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:46:14 Download gff for BS17373.complete
Subject Subject Range Query Range Percent Splice Strand
CG30354-RA 1..261 17..277 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-09 18:16:40 Download gff for BS17373.complete
Subject Subject Range Query Range Percent Splice Strand
CG30354-RA 9..263 17..271 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:38:20 Download gff for BS17373.complete
Subject Subject Range Query Range Percent Splice Strand
CG30354-RA 61..315 17..271 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:46:14 Download gff for BS17373.complete
Subject Subject Range Query Range Percent Splice Strand
CG30354-RA 5..273 10..285 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:45:21 Download gff for BS17373.complete
Subject Subject Range Query Range Percent Splice Strand
CG30354-RA 61..315 17..271 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:45:21 Download gff for BS17373.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8677335..8677589 17..271 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:38:20 Download gff for BS17373.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4564840..4565094 17..271 100   Plus

BS17373.3prime Sequence

291 bp (291 high quality bases) assembled on 2007-05-15

> BS17373.3prime
ATGGTCTAGAAAGCTTCTATTTGAGTTTCGAGAAGAGACTGTGAGCAACG
CAATGATCCAATTCAGCGACGAAGTCGAACAATTCCTCCATGCATGTCTC
AGTGGTTTTGGACTTGCCATTCACACGATCATTGCACTCTTGATACTTGT
TGTACAGGGACGCAATGTGACCTTTGGCCTGGCACTTCTCCCTAAGGGCT
GCTTGCGGATCAACTAACTCCTTTTCGTCATCATCGGCCTTGAGGACAGG
CACCAAAACCCGGCTATTAAACGCCATGTCGACTGATAACT

BS17373.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:33:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG30354-PA 261 CG30354-RA 1..261 277..17 1305 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:09:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG30354-RB 443 CG30354-RB 117..377 277..17 1305 100 Minus
CG30354-RA 387 CG30354-RA 61..321 277..17 1305 100 Minus
Ucrh-RD 506 CG41623-RD 136..333 233..36 435 81.9 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:09:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8677335..8677595 277..17 1305 100 Minus
3L 28110227 3L 25121043..25121198 191..36 345 81.4 Minus
Blast to na_te.dros performed on 2015-02-12 10:09:36 has no hits.

BS17373.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:33:46 Download gff for BS17373.3prime
Subject Subject Range Query Range Percent Splice Strand
CG30354-PA 1..261 17..277 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 20:53:39 Download gff for BS17373.3prime
Subject Subject Range Query Range Percent Splice Strand
CG30354-RA 57..325 9..284 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:09:31 Download gff for BS17373.3prime
Subject Subject Range Query Range Percent Splice Strand
CG30354-RA 57..325 9..284 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:09:31 Download gff for BS17373.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 8677331..8677594 18..284 98 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 20:53:39 Download gff for BS17373.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4564836..4565099 18..284 98 -> Minus

BS17373.5prime Sequence

291 bp (291 high quality bases) assembled on 2007-05-15

> BS17373.5prime
GAAGTTATCAGTCGACATGGCGTTTAATAGCCGGGTTTTGGTGCCTGTCC
TCAAGGCCGATGATGACGAAAAGGAGTTAGTTGATCCGCAAGCAGCCCTT
AGGGAGAAGTGCCAGGCCAAAGGTCACATTGCGTCCCTGTACAACAAGTA
TCAAGAGTGCAATGATCGTGTGAATGGCAAGTCCAAAACCACTGAGACAT
GCATGGAGGAATTGTTCGACTTCGTCGCTGAATTGGATCATTGCGTTGCT
CACAGTCTCTTCTCGAAACTCAAATAGAAGCTTTCTAGACC

BS17373.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:26:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG30354-PA 261 CG30354-RA 1..261 17..277 1305 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 15:15:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG30354-RB 443 CG30354-RB 117..377 17..277 1305 100 Plus
CG30354-RA 387 CG30354-RA 61..321 17..277 1305 100 Plus
Ucrh-RD 506 CG41623-RD 136..333 61..258 435 81.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 15:15:36
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8677335..8677595 17..277 1305 100 Plus
3L 28110227 3L 25121043..25121198 103..258 345 81.4 Plus
Blast to na_te.dros performed on 2015-02-10 15:15:40 has no hits.

BS17373.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:26:21 Download gff for BS17373.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30354-PA 1..261 17..277 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-15 06:21:02 Download gff for BS17373.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30354-RA 57..325 10..285 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:17:19 Download gff for BS17373.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30354-RA 57..325 10..285 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:17:19 Download gff for BS17373.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 8677331..8677594 10..276 98 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-15 06:21:02 Download gff for BS17373.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4564836..4565099 10..276 98 -> Plus

BS17373.pep Sequence

Translation from 16 to 276

> BS17373.pep
MAFNSRVLVPVLKADDDEKELVDPQAALREKCQAKGHIASLYNKYQECND
RVNGKSKTTETCMEELFDFVAELDHCVAHSLFSKLK*

BS17373.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:50:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG30354-PB 86 CG30354-PB 1..86 1..86 450 100 Plus
CG30354-PA 86 CG30354-PA 1..86 1..86 450 100 Plus
Ucrh-PD 85 CG41623-PD 1..85 1..86 360 77.9 Plus
Ucrh-PC 85 CG41623-PC 1..85 1..86 360 77.9 Plus
Ucrh-PB 85 CG41623-PB 1..85 1..86 360 77.9 Plus