Clone BS17389 Report

Search the DGRC for BS17389

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:173
Well:89
Vector:pDNR-Dual
Associated Gene/TranscriptCG5693-RA
Protein status:BS17389.pep: full length peptide match
Sequenced Size:251

Clone Sequence Records

BS17389.complete Sequence

251 bp assembled on 2010-02-09

GenBank Submission: KX806338

> BS17389.complete
GAAGTTATCAGTCGACATGCCTTGCATATTTAATCCGGGCTACATTGGAC
CCGATCCGCCCTGCTGTGACCCCGATTGCTTGGAGGAGGGCCACTGCACG
GTTCCGGAGTGCGGAGTTTGCCCGGAGTCCCAACTACCCCGATGCAATCC
CGCCCCACAATCCAACAAGGACGCGGCGAAGCAACCACTGGACCAGAAAG
CCCAAAAAGAACCGAAGCTCCGGGAACAGAAGTAGAAGCTTTCTAGACCA
T

BS17389.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 03:00:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG5693-RA 219 CG5693-PA 1..219 17..235 1095 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:00:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG5693-RA 590 CG5693-RA 156..375 16..235 1100 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 03:00:46
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18006782..18007001 16..235 1100 100 Plus
Blast to na_te.dros performed on 2014-11-28 03:00:47 has no hits.

BS17389.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:19:19 Download gff for BS17389.complete
Subject Subject Range Query Range Percent Splice Strand
CG5693-RA 1..219 17..235 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-09 18:14:11 Download gff for BS17389.complete
Subject Subject Range Query Range Percent Splice Strand
CG5693-RA 105..323 17..235 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:32:53 Download gff for BS17389.complete
Subject Subject Range Query Range Percent Splice Strand
CG5693-RA 157..375 17..235 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:19:19 Download gff for BS17389.complete
Subject Subject Range Query Range Percent Splice Strand
CG5693-RA 104..323 16..235 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:40:43 Download gff for BS17389.complete
Subject Subject Range Query Range Percent Splice Strand
CG5693-RA 157..375 17..235 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:40:43 Download gff for BS17389.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18006783..18007001 17..235 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:32:53 Download gff for BS17389.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18006783..18007001 17..235 100   Plus

BS17389.5prime Sequence

249 bp (249 high quality bases) assembled on 2007-05-15

> BS17389.5prime
GAAGTTATCAGTCGACATGCCTTGCATATTTAATCCGGGCTACATTGGAC
CCGATCCGCCCTGCTGTGACCCCGATTGCTTGGAGGAGGGCCACTGCACG
GTTCCGGAGTGCGGAGTTTGCCCGGAGTCCCAACTACCCCGATGCAATCC
CGCCCCACAATCCAACAAGGACGCGGCGAAGCAACCACTGGACCAGAAAG
CCCAAAAAGAACCGAAGCTCCGGGAACAGAAGTAGAAGCTTTCTAGACC

BS17389.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:30:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG5693-PA 219 CG5693-RA 1..219 17..235 1095 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 16:40:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG5693-RA 590 CG5693-RA 156..375 16..235 1100 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 16:40:36
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18006782..18007001 16..235 1100 100 Plus
Blast to na_te.dros performed on 2015-02-11 16:40:39 has no hits.

BS17389.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:30:45 Download gff for BS17389.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5693-PA 1..219 17..235 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 19:51:23 Download gff for BS17389.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5693-RA 156..375 16..235 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:48:45 Download gff for BS17389.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5693-RA 156..375 16..235 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:48:45 Download gff for BS17389.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 18006782..18007000 16..234 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 19:51:23 Download gff for BS17389.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18006782..18007000 16..234 100 -> Plus

BS17389.3prime Sequence

249 bp (249 high quality bases) assembled on 2007-05-15

> BS17389.3prime
ATGGTCTAGAAAGCTTCTACTTCTGTTCCCGGAGCTTCGGTTCTTTTTGG
GCTTTCTGGTCCAGTGGTTGCTTCGCCGCGTCCTTGTTGGATTGTGGGGC
GGGATTGCATCGGGGTAGTTGGGACTCCGGGCAAACTCCGCACTCCGGAA
CCGTGCAGTGGCCCTCCTCCAAGCAATCGGGGTCACAGCAGGGCGGATCG
GGTCCAATGTAGCCCGGATTAAATATGCAAGGCATGTCGACTGATAACT

BS17389.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:37:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG5693-PA 219 CG5693-RA 1..219 235..17 1095 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:12:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG5693-RA 590 CG5693-RA 156..375 236..17 1100 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 18:12:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18006782..18007001 236..17 1100 100 Minus
Blast to na_te.dros performed on 2015-02-10 18:12:10 has no hits.

BS17389.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:37:59 Download gff for BS17389.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5693-PA 1..219 17..235 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 02:32:30 Download gff for BS17389.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5693-RA 156..375 17..236 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 19:17:26 Download gff for BS17389.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5693-RA 156..375 17..236 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 19:17:26 Download gff for BS17389.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 18006782..18007000 18..236 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 02:32:30 Download gff for BS17389.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18006782..18007000 18..236 100 -> Minus

BS17389.pep Sequence

Translation from 16 to 234

> BS17389.pep
MPCIFNPGYIGPDPPCCDPDCLEEGHCTVPECGVCPESQLPRCNPAPQSN
KDAAKQPLDQKAQKEPKLREQK*

BS17389.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:17:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG5693-PA 72 CG5693-PA 1..72 1..72 422 100 Plus