Clone BS17506 Report

Search the DGRC for BS17506

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:175
Well:6
Vector:pDNR-Dual
Associated Gene/TranscriptDpy-30L2-RA
Protein status:BS17506.pep: full length peptide match
Sequenced Size:329

Clone Sequence Records

BS17506.complete Sequence

329 bp assembled on 2010-02-09

GenBank Submission: KX801956

> BS17506.complete
GAAGTTATCAGTCGACATGCCGGTTTCCCCTGGAGAGGGGGAAGTCAATG
GCGGCGGAGATGTGGCCAAGAACGACTCCAACTCGCAGCAATCGGTGGAT
GGAATCGATGCGTTCGCCGCCTGCCAGAAGCCGCGTCCGGACACCAGTTC
CATGCCGGTTCGCCAGTACCTCGACCAGACGGTGGCCCCCATTTTGCTGC
ACGGACTGCAGGCTTTGGCCCGGGATCGCCCCAGTGATCCGATCAGCTAC
CTGGCCACCTATCTGCTGAAGAACAAGAACCGCTGCGATGAGGTCAAGAC
AGAAGAAAACTAGAAGCTTTCTAGACCAT

BS17506.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 03:12:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpy-30L2-RB 297 CG11591-PB 1..297 17..313 1485 100 Plus
Dpy-30L2-RA 297 CG11591-PA 1..297 17..313 1485 100 Plus
Dpy-30L1-RA 405 CG6444-PA 238..345 164..271 180 77.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:12:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpy-30L2-RB 506 CG11591-RB 45..341 17..313 1485 100 Plus
Dpy-30L2-RA 550 CG11591-RA 89..385 17..313 1485 100 Plus
Dpy-30L1-RA 655 CG6444-RA 403..510 164..271 180 77.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 03:12:21
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4047153..4047449 313..17 1485 100 Minus
2L 23513712 2L 10733055..10733162 164..271 180 77.8 Plus
Blast to na_te.dros performed 2014-11-28 03:12:22
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy 7469 gypsy DMGYPF1A 7469bp Derived from M12927 (g157583) (Rel. 44, Last updated, Version 6). 3467..3504 288..325 109 76.3 Plus

BS17506.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:44:11 Download gff for BS17506.complete
Subject Subject Range Query Range Percent Splice Strand
CG11591-RA 1..297 17..313 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-09 18:16:31 Download gff for BS17506.complete
Subject Subject Range Query Range Percent Splice Strand
CG11591-RA 89..385 17..313 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:38:04 Download gff for BS17506.complete
Subject Subject Range Query Range Percent Splice Strand
Dpy-30L2-RA 89..385 17..313 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:44:11 Download gff for BS17506.complete
Subject Subject Range Query Range Percent Splice Strand
CG11591-RA 84..393 9..320 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:45:11 Download gff for BS17506.complete
Subject Subject Range Query Range Percent Splice Strand
Dpy-30L2-RA 89..385 17..313 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:45:11 Download gff for BS17506.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4047153..4047449 17..313 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:38:04 Download gff for BS17506.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4047153..4047449 17..313 100   Minus

BS17506.5prime Sequence

327 bp (327 high quality bases) assembled on 2007-05-15

> BS17506.5prime
GAAGTTATCAGTCGACATGCCGGTTTCCCCTGGAGAGGGGGAAGTCAATG
GCGGCGGAGATGTGGCCAAGAACGACTCCAACTCGCAGCAATCGGTGGAT
GGAATCGATGCGTTCGCCGCCTGCCAGAAGCCGCGTCCGGACACCAGTTC
CATGCCGGTTCGCCAGTACCTCGACCAGACGGTGGCCCCCATTTTGCTGC
ACGGACTGCAGGCTTTGGCCCGGGATCGCCCCAGTGATCCGATCAGCTAC
CTGGCCACCTATCTGCTGAAGAACAAGAACCGCTGCGATGAGGTCAAGAC
AGAAGAAAACTAGAAGCTTTCTAGACC

BS17506.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:44:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG11591-PA 297 CG11591-RA 1..297 17..313 1485 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 16:16:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpy-30L2-RB 506 CG11591-RB 45..341 17..313 1485 100 Plus
Dpy-30L2-RA 550 CG11591-RA 89..385 17..313 1485 100 Plus
Dpy-30L1-RA 655 CG6444-RA 403..510 164..271 195 79.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 16:16:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4047153..4047449 313..17 1485 100 Minus
2L 23513712 2L 10733055..10733162 164..271 180 77.8 Plus
Blast to na_te.dros performed 2015-02-12 16:16:41
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy 7469 gypsy DMGYPF1A 7469bp Derived from M12927 (g157583) (Rel. 44, Last updated, Version 6). 3467..3504 288..325 109 76.3 Plus

BS17506.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:44:47 Download gff for BS17506.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11591-PA 1..297 17..313 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 15:17:55 Download gff for BS17506.5prime
Subject Subject Range Query Range Percent Splice Strand
Dpy-30L2-RA 84..393 9..320 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 18:32:46 Download gff for BS17506.5prime
Subject Subject Range Query Range Percent Splice Strand
Dpy-30L2-RA 84..393 9..320 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 18:32:46 Download gff for BS17506.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 4047145..4047460 8..320 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 15:17:55 Download gff for BS17506.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4047145..4047460 8..320 97   Minus

BS17506.3prime Sequence

327 bp (327 high quality bases) assembled on 2007-05-15

> BS17506.3prime
ATGGTCTAGAAAGCTTCTAGTTTTCTTCTGTCTTGACCTCATCGCAGCGG
TTCTTGTTCTTCAGCAGATAGGTGGCCAGGTAGCTGATCGGATCACTGGG
GCGATCCCGGGCCAAAGCCTGCAGTCCGTGCAGCAAAATGGGGGCCACCG
TCTGGTCGAGGTACTGGCGAACCGGCATGGAACTGGTGTCCGGACGCGGC
TTCTGGCAGGCGGCGAACGCATCGATTCCATCCACCGATTGCTGCGAGTT
GGAGTCGTTCTTGGCCACATCTCCGCCGCCATTGACTTCCCCCTCTCCAG
GGGAAACCGGCATGTCGACTGATAACT

BS17506.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:50:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG11591-PA 297 CG11591-RA 1..297 313..17 1485 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 05:32:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpy-30L2-RB 506 CG11591-RB 45..341 313..17 1485 100 Minus
Dpy-30L2-RA 550 CG11591-RA 89..385 313..17 1485 100 Minus
Dpy-30L1-RA 655 CG6444-RA 403..510 166..59 195 79.8 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 05:32:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4047153..4047449 17..313 1485 100 Plus
2L 23513712 2L 10733055..10733162 166..59 180 77.8 Minus
Blast to na_te.dros performed 2015-02-12 05:32:17
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy 7469 gypsy DMGYPF1A 7469bp Derived from M12927 (g157583) (Rel. 44, Last updated, Version 6). 3467..3504 42..5 109 76.3 Minus

BS17506.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-15 18:50:55 Download gff for BS17506.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11591-PA 1..297 17..313 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 05:43:27 Download gff for BS17506.3prime
Subject Subject Range Query Range Percent Splice Strand
Dpy-30L2-RA 84..393 10..321 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:39:20 Download gff for BS17506.3prime
Subject Subject Range Query Range Percent Splice Strand
Dpy-30L2-RA 84..393 10..321 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:39:20 Download gff for BS17506.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 4047145..4047460 10..322 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 05:43:27 Download gff for BS17506.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4047145..4047460 10..322 97   Plus

BS17506.pep Sequence

Translation from 16 to 312

> BS17506.pep
MPVSPGEGEVNGGGDVAKNDSNSQQSVDGIDAFAACQKPRPDTSSMPVRQ
YLDQTVAPILLHGLQALARDRPSDPISYLATYLLKNKNRCDEVKTEEN*

BS17506.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:54:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpy-30L2-PB 98 CG11591-PB 1..98 1..98 512 100 Plus
Dpy-30L2-PA 98 CG11591-PA 1..98 1..98 512 100 Plus
Dpy-30L1-PA 134 CG6444-PA 64..122 34..92 226 67.8 Plus