Clone BS17689 Report

Search the DGRC for BS17689

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:176
Well:89
Vector:pDNR-Dual
Associated Gene/TranscriptCG13053-RA
Protein status:BS17689.pep: full length peptide match
Sequenced Size:308

Clone Sequence Records

BS17689.complete Sequence

308 bp assembled on 2010-02-09

GenBank Submission: KX803144

> BS17689.complete
GAAGTTATCAGTCGACATGCGCAATTATCTCTGGTTAGCAGTGCTCCTGG
TGGTGGCCACCACCTGCATCAAGGCCAAGCCGCTGGTCTCCTTCGGTGTC
AGCTACCAGCAGCCTTACCTGGGCCCCCAGCCAGAATCCTACTACTACGG
AGGACGGTACCCGGCTGGTGGCTACTACAACAACTACCACAACAGCCCGG
GTCCGTACGGCTACCCCTATCCGTATGCCAATCGCTATGGTGCCCTCGAT
CTCGGAATCGGCGCCCTGTCGCTATCGTCGTTCCTGCTCTGAAAGCTTTC
TAGACCAT

BS17689.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 03:08:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG13053-RB 276 CG13053-PB 1..276 17..292 1380 100 Plus
CG13053-RA 276 CG13053-PA 1..276 17..292 1380 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:08:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG13053-RB 620 CG13053-RB 297..572 17..292 1380 100 Plus
CG13053-RA 358 CG13053-RA 35..310 17..292 1380 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 03:08:13
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16259085..16259343 292..34 1295 100 Minus
Blast to na_te.dros performed on 2014-11-28 03:08:14 has no hits.

BS17689.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:27:16 Download gff for BS17689.complete
Subject Subject Range Query Range Percent Splice Strand
CG13053-RA 1..276 17..292 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-09 18:15:32 Download gff for BS17689.complete
Subject Subject Range Query Range Percent Splice Strand
CG13053-RA 35..309 17..291 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:36:18 Download gff for BS17689.complete
Subject Subject Range Query Range Percent Splice Strand
CG13053-RA 35..309 17..291 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:27:16 Download gff for BS17689.complete
Subject Subject Range Query Range Percent Splice Strand
CG13053-RA 29..310 9..292 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:43:40 Download gff for BS17689.complete
Subject Subject Range Query Range Percent Splice Strand
CG13053-RA 35..309 17..291 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:43:40 Download gff for BS17689.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16259086..16259342 35..291 100 <- Minus
3L 16259409..16259426 17..34 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:36:18 Download gff for BS17689.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16252186..16252442 35..291 100 <- Minus
arm_3L 16252509..16252526 17..34 100   Minus

BS17689.5prime Sequence

306 bp (306 high quality bases) assembled on 2007-05-29

> BS17689.5prime
GAAGTTATCAGTCGACATGCGCAATTATCTCTGGTTAGCAGTGCTCCTGG
TGGTGGCCACCACCTGCATCAAGGCCAAGCCGCTGGTCTCCTTCGGTGTC
AGCTACCAGCAGCCTTACCTGGGCCCCCAGCCAGAATCCTACTACTACGG
AGGACGGTACCCGGCTGGTGGCTACTACAACAACTACCACAACAGCCCGG
GTCCGTACGGCTACCCCTATCCGTATGCCAATCGCTATGGTGCCCTCGAT
CTCGGAATCGGCGCCCTGTCGCTATCGTCGTTCCTGCTCTGAAAGCTTTC
TAGACC

BS17689.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-08-06 11:20:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG13053-PA 276 CG13053-RA 1..276 17..292 1380 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 07:13:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG13053-RB 620 CG13053-RB 297..572 17..292 1380 100 Plus
CG13053-RA 358 CG13053-RA 35..310 17..292 1380 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 07:13:38
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16259085..16259343 292..34 1295 100 Minus
Blast to na_te.dros performed on 2015-02-13 07:13:39 has no hits.

BS17689.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-08-06 11:20:21 Download gff for BS17689.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13053-PA 1..276 17..292 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 01:06:47 Download gff for BS17689.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13053-RA 29..310 9..292 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 09:18:45 Download gff for BS17689.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13053-RA 29..310 9..292 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 09:18:45 Download gff for BS17689.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 16259085..16259342 35..292 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 01:06:47 Download gff for BS17689.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16252185..16252442 35..292 100 <- Minus

BS17689.3prime Sequence

306 bp (306 high quality bases) assembled on 2007-05-29

> BS17689.3prime
ATGGTCTAGAAAGCTTTCAGAGCAGGAACGACGATAGCGACAGGGCGCCG
ATTCCGAGATCGAGGGCACCATAGCGATTGGCATACGGATAGGGGTAGCC
GTACGGACCCGGGCTGTTGTGGTAGTTGTTGTAGTAGCCACCAGCCGGGT
ACCGTCCTCCGTAGTAGTAGGATTCTGGCTGGGGGCCCAGGTAAGGCTGC
TGGTAGCTGACACCGAAGGAGACCAGCGGCTTGGCCTTGATGCAGGTGGT
GGCCACCACCAGGAGCACTGCTAACCAGAGATAATTGCGCATGTCGACTG
ATAACT

BS17689.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-08-06 11:20:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG13053-PA 276 CG13053-RA 1..276 292..17 1380 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-05 13:50:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG13053-RB 620 CG13053-RB 297..572 292..17 1380 100 Minus
CG13053-RA 358 CG13053-RA 35..310 292..17 1380 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-05 13:50:46
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16259085..16259343 17..275 1295 100 Plus
Blast to na_te.dros performed on 2015-02-05 13:50:50 has no hits.

BS17689.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-08-06 11:20:17 Download gff for BS17689.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13053-PA 1..276 17..292 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-10 22:09:45 Download gff for BS17689.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13053-RA 29..310 17..300 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-05 16:15:13 Download gff for BS17689.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13053-RA 29..310 17..300 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-05 16:15:13 Download gff for BS17689.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 16259085..16259342 17..274 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-10 22:09:45 Download gff for BS17689.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16252185..16252442 17..274 100 <- Plus

BS17689.pep Sequence

Translation from 16 to 291

> BS17689.pep
MRNYLWLAVLLVVATTCIKAKPLVSFGVSYQQPYLGPQPESYYYGGRYPA
GGYYNNYHNSPGPYGYPYPYANRYGALDLGIGALSLSSFLL*

BS17689.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:16:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG13053-PB 91 CG13053-PB 1..91 1..91 502 100 Plus
CG13053-PA 91 CG13053-PA 1..91 1..91 502 100 Plus